KEGG   Novosphingobium tardaugens: EGO55_00105Help
Entry
EGO55_00105       CDS       T05741                                 

Definition
(GenBank) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
ntd  Novosphingobium tardaugens
Pathway
ntd00020  Citrate cycle (TCA cycle)
ntd00190  Oxidative phosphorylation
ntd00650  Butanoate metabolism
ntd01100  Metabolic pathways
ntd01110  Biosynthesis of secondary metabolites
ntd01120  Microbial metabolism in diverse environments
ntd01130  Biosynthesis of antibiotics
ntd01200  Carbon metabolism
Module
ntd_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ntd_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
ntd_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:ntd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    EGO55_00105
   00650 Butanoate metabolism
    EGO55_00105
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    EGO55_00105
Enzymes [BR:ntd01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     EGO55_00105
    1.3.5.4  fumarate reductase (quinol)
     EGO55_00105
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C GIDA Pyr_redox_2 Thi4
Motif
Other DBs
NCBI-ProteinID: AZI34535
UniProt: U2ZRN8
LinkDB All DBs
Position
complement(20363..22198)
Genome map
AA seq 611 aa AA seqDB search
MASASTQAAYKIIDHTYDTVVVGAGGSGLRATMGSAEAGLKTACITKVFPTRSHTVAAQG
GIAASLGNNSPDHWTWHMYDTVKGSDWLGDQDAIEYMVREAPQAVYELEHAGVPFSRNAD
GTIYQRPFGGHMQNMGEGPPVQRTCAAADRTGHAMLHALYQQSLKYDADFFIEYFAIDLI
MENGPDGVPVCRGVIAMCMDDGSIHRFRSHAVVLATGGYGRSYFTATSAHTCTGDGGGMV
LRAGLPMQDMEFVQFHPTGIYGAGVLITEGARGEGGYLTNSEGERFMERYAPSAKDLASR
DVVSRSMAMEIREGRGVGPHKDHIYLHLDHIDPKVLAERLPGITESGKIFAGVDLARQPL
PVVPTVHYNMGGIPCNYHGEVVTIGADGNPETVVPGLFAVGEAACVSVHGANRLGSNSLI
DLVVFGRATGHRLKELIKPGTAHNGLPKDSADLALGRLDHFRNAKGGSPTAEVRTEMQRT
MSAHAAVFRTDELMAEGVTKLADTYKRMQDIHVSDRSLIWNSDLIETLELDNLISQASVT
MSGAYARKESRGAHAHEDFPNRDDANWMKHTVGWFNGWGGKGGEVKLDYRPVHEFTLTDD
VQYIKPKARVY
NT seq 1836 nt NT seq  +upstreamnt  +downstreamnt
atggcttccgcatctactcaggccgcatacaagattatcgatcacacctatgatacggtg
gttgtcggcgctggcggctctggtctgcgcgctacgatgggttcggctgaagccggtctg
aaaaccgcctgcatcaccaaggtgttcccgacccgttcgcataccgtggcggcgcagggt
ggtattgccgcgtcgctcggcaacaactcgccggaccactggacctggcacatgtacgac
accgtgaaggggtcggactggctgggcgatcaggacgcgatcgaatacatggtgcgcgaa
gcgccgcaggcggtttacgagcttgaacatgccggtgtgccgttcagccgcaacgccgat
ggcacgatttaccagcgcccgttcggcggtcacatgcagaatatgggggaaggcccgccg
gtgcagcgcacttgtgctgccgccgaccgtaccggccacgccatgctgcacgcgctttat
cagcagtcgctgaagtacgatgcagacttcttcatcgaatacttcgcgatcgacctgatc
atggaaaacggccctgatggcgttccggtctgccgtggcgtgatcgccatgtgcatggac
gatggttcgatccaccgtttccgcagccacgccgttgtgctcgccactggcggatacgga
cgcagctatttcaccgcgacctcggcccacacctgcaccggcgacggtggcgggatggta
ctgcgcgcgggcctgccgatgcaggacatggaattcgtgcagttccaccctacggggatt
tacggtgcgggcgtgttgatcaccgaaggcgcgcgcggcgaaggtggttatctcaccaac
tccgagggtgagcgttttatggaacgctatgcgccgtcggccaaggatctcgccagccgc
gacgttgtgtcgcgttcgatggcgatggaaatccgcgaaggtcgcggtgtaggcccgcac
aaggaccatatctaccttcacctcgatcatatcgatcccaaggtgctggcagaacgtctg
cccggcattaccgaaagcggcaagattttcgctggcgtggatctggcccgccagcctttg
cccgtggttccgactgtgcattacaacatgggcggtatcccctgtaactatcacggcgaa
gtcgtcaccatcggtgccgatgggaacccggaaacggttgtgccgggtctgttcgctgtg
ggcgaagccgcctgcgtgtccgtccacggtgcaaaccgtctcggatcgaactccctgatc
gatctcgtggtgttcggccgtgcgaccggccatcgcctgaaggaactgatcaagccgggc
acggcccacaacggtctacccaaggattcggccgatctggcgctgggccgcctcgatcac
ttccgcaatgccaaggggggttctcccaccgcggaagtccgcaccgaaatgcagcgtacc
atgtcggcccatgccgctgtgttccgcacggatgaactgatggccgaaggcgtgaccaag
ctggccgatacctacaagcgcatgcaggacattcacgtgtctgaccgttcgctgatctgg
aattcggacctgatcgaaacgctggaactcgataacctgatctcgcaggccagcgtcacg
atgagcggcgcctacgcccgcaaggaaagccgcggcgcccatgcgcacgaggatttcccg
aaccgtgacgatgccaactggatgaagcacaccgttggctggttcaacggatggggcggc
aagggcggcgaggtgaagctcgattaccgtccggtccacgaattcacgctgaccgacgat
gttcagtacatcaagcccaaggcccgcgtatattga

DBGET integrated database retrieval system