KEGG   Novosphingobium tardaugens: EGO55_01805Help
Entry
EGO55_01805       CDS       T05741                                 

Definition
(GenBank) sulfite exporter TauE/SafE family protein
  KO
K07090  uncharacterized protein
Organism
ntd  Novosphingobium tardaugens
Brite
KEGG Orthology (KO) [BR:ntd00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    EGO55_01805
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TauE TerC EptA_B_N DUF1673
Motif
Other DBs
NCBI-ProteinID: AZI34841
UniProt: U3A0U3
LinkDB All DBs
Position
347616..348404
Genome map
AA seq 262 aa AA seqDB search
MTSFYQFDSAHAVAGALVGVLVGLTGVGGGSLMTPLLVLLFGVNPKTAVGTDLLFAALTK
AIGSTVHGWRDTVDWHVFRRLATGSLPAAILSVLALQWFGEIGHRTENMIVLLLGCMLIV
TAIATLFQPRLVAFAQHHRIPNGRHALMPTIALGAFIGVAVSISSVGAGAIGVTALLMLY
PSLPLSRIIGTDIAHAVPLALVAGSGHWYYGDVDPVLLVSLLAGSIPGVIVGSLLASHAP
DRLLRPALAAVLLLVGVKMLLN
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgacctcgttttatcaattcgatagcgcgcatgccgttgcgggagccctggtcggcgtg
ctggtcggattgaccggcgtgggcggcggatcgttgatgacgccgctgctggtgctgctg
ttcggggtcaatcccaagacagccgtgggcaccgacctgctgttcgcggcactgacgaag
gcaatcggcagcaccgtacacggctggcgcgatacggtggactggcatgtcttccgccgg
ctcgcgaccggctcgctgcccgctgccatcctgtcggtactggccctacaatggttcggc
gagatcgggcatcggaccgaaaatatgatcgtcctgctgctgggctgcatgctgatcgtc
actgcgatcgccacgctttttcagccccggctggtggcgtttgcgcagcatcaccgcatt
cccaacgggcggcatgcgctgatgccgaccatcgcgctcggcgcctttatcggggtcgcc
gtgtcgatctcatcggtcggagccggggcgatcggcgtcaccgcgctgctgatgctctat
cccagtctgccgctgtcgcggatcatcgggaccgatatcgcccatgcggtcccgctggcc
ctggtggcgggttccggccactggtattatggcgatgtcgatccggttctgctggtcagc
ctgctggcagggtcgatccccggtgtcatcgtcggcagccttctggcaagccatgcgccc
gaccgcctgttgcgcccggcgctggcggcggtacttctccttgtcggggtaaagatgctg
ctcaactag

DBGET integrated database retrieval system