KEGG   Novosphingobium tardaugens: EGO55_06030Help
Entry
EGO55_06030       CDS       T05741                                 

Definition
(GenBank) aldehyde dehydrogenase
Organism
ntd  Novosphingobium tardaugens
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh LuxC Dpy-30
Motif
Other DBs
NCBI-ProteinID: AZI35570
UniProt: U2YNJ5
LinkDB All DBs
Position
complement(1334297..1335775)
Genome map
AA seq 492 aa AA seqDB search
MSEHAVHLRNPEKLFIGGEWVRPSGDSQFTVVSAHNEQPYVRVAEATADDVERAVAGARK
AFDGPWSRTTHAERAAYLGQIAAKLMERSGEVASAWTNQMGILSGAAQMGAPAAAGAFAS
YVELAATFPFEEQVTPSYGGGNGLLVREPVGVVAAIVPWNAPLTLMAYKVAPALLAGCTV
IVKVSPEAPIEGYILAEICEEIGLPAGVLTMLTADRAVSELLVRHPGVDKVSFTGSTVAG
RRIASLCGERIARCSLELGGKSAAVILDDYPLETAAQSLTQSLMFMSGQVCASLTRVVVT
QNRHDELVDALRQAFGTITVGDPYDPGTMLGPLAMERQRDRVLNYIQQGQAQGGQLVCGG
GRPAELDRGWFVEPTLFANVDNASVIAQEEIFGPVLSVIPARDEEDAIRIANDTIYGLNN
AVFSTDNDAAYRVGRRLRSGTVGQNGFRTDFGIAFGGFKQSGIGREGGREGLLPYLETKT
MLLDGLPSHLAS
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagcatgccgtacatctgcgtaaccccgaaaagctctttatcggcggggaatgg
gttcgcccgtccggagacagccagttcaccgtcgtttcggcgcacaacgaacaaccctat
gtcagggtcgccgaagcgacggcggatgatgtggagcgcgcggtggctggcgcccgcaag
gcttttgacggcccgtggtcacgcaccacgcatgcggaacgcgccgcctatctcggccag
attgcggccaagctgatggaacggtcaggcgaagtggccagtgcctggaccaaccagatg
ggtatcctgagcggtgccgcgcagatgggcgccccggccgccgcgggtgcgttcgcatcc
tatgtcgaactggcagcgacgtttcccttcgaagaacaggtgacacccagctatggcggg
ggcaacgggctgcttgtgcgcgaaccggttggcgtcgtggcggcaatcgtgccgtggaac
gccccgctcaccctgatggcctacaaggtggccccggcactgctggcgggctgcacagtg
attgtcaaagtttcccccgaagcccccatcgaagggtatattctggccgaaatctgcgaa
gaaatcggcttgcccgccggggttttgacgatgctgaccgcggatcgcgcggtgtcggaa
ctgctcgtgcggcatcccggggtggacaaggtcagcttcaccggttcgacagtggcaggg
cggcggatcgcttcgctgtgcggcgaacgcattgcgcgctgttcgctggaactggggggc
aagtccgctgcggtcattctcgatgactatccgctggaaacggcggcccagtcgctcacg
cagtcgctgatgttcatgagcggtcaggtctgcgcctcgctgacgcgggtggtggtcacg
cagaaccgccacgatgaactggtcgatgcgctgcgtcaggcgttcggcacgatcacggtg
ggcgatccctacgatcccggcaccatgctcggcccgctggcgatggagcggcagcgtgat
cgcgtgctgaactacatccagcaggggcaggcgcagggtggccagttggtatgcggcggg
ggccgaccggccgaactcgatcgcggctggttcgtggaaccgacgctgtttgccaatgtc
gacaatgccagtgtgattgcacaggaagaaatcttcggcccggtgctgagcgttattccc
gcccgtgacgaggaagacgccatccgcattgccaatgacacgatctacggcctgaacaac
gccgttttctccacggacaacgacgccgcctatcgcgtgggccggcgcctgcgttcgggc
acggtcgggcagaacgggttccgcaccgatttcggcatcgcctttggcggcttcaagcag
tcggggattggccgcgaaggcgggcgggaggggttgctgccctatctcgaaaccaagacc
atgctgctggatggcctgccgtcgcatctggcatcctga

DBGET integrated database retrieval system