KEGG   Novosphingobium tardaugens: EGO55_10390Help
Entry
EGO55_10390       CDS       T05741                                 

Gene name
ligD
Definition
(GenBank) DNA ligase D
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
ntd  Novosphingobium tardaugens
Pathway
ntd03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:ntd00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    EGO55_10390 (ligD)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ntd03400]
    EGO55_10390 (ligD)
Enzymes [BR:ntd01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     EGO55_10390 (ligD)
DNA repair and recombination proteins [BR:ntd03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     EGO55_10390 (ligD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_M DNA_ligase_A_C DNA_primase_S Med4
Motif
Other DBs
NCBI-ProteinID: AZI36313
UniProt: U3A819
LinkDB All DBs
Position
complement(2266013..2268541)
Genome map
AA seq 842 aa AA seqDB search
MASADPLSRYNEKRDFTRTSEPAGKTGRSTDGNLFIVQKHGATRLHWDFRLEADGVLKSW
AITKGPSTDPDDKRLAVRTEDHPLSYARFEGTIPKGEYGGGTVMLWDQGTWEPVEGKSAK
DIEKGHLHFRLHGERMKGEWLLVRMRPRPGEKRENWLLRKIADAYASNSADLVEQGLTSV
LTGRSMAQIAADKAGTHPLQNKKGKDFDAAMKKAARHNAGLRPKTARTRKDASSALPTFQ
PVQLATLVDTIPTGNGWMHEIKFDGYRALVAASSSKVRIYTRSSLDWTDKFEPLAQQIAA
LDLPPCLIDGEIVAYDSQGNPDFSALQNVLKRGHGQQQEKDHLAFHAFDLLLQDGLDLKP
LPAIERKERLEALLADSRPPVHVADHVIGAGEKLFSAMCVAGQEGIIAKRVDAPYRGERT
RNWVKVKCTRRQEFVIIGWTTSGTRGRAFKSLLLAQREGDVLVYKGKVGTGFNSATMDDL
ANRIATLTRKTAPAPVPRAEARGAHWVTPKLVAEVAFAEFTAEGRVRHGSFIALRTDKTA
QEVKPERALAAPQETAAIRITHPDRVIFPETGETKGDLATYYESIAPLMLPFAAHRPISL
VRCPQGRARKCFFQKHDSGSFGPHVSHVPIAEKHGGVEDYLYVTDTAGLLACVQMGTIEF
HGWCASTADVEHPDRMIFDLDPDEGLDFAEVKRAARQIRQHLADLGLVSFAMLSGGKGVH
VVLPLTPGHDWAVHKDFAKRFAEALSIAEPERFTATMSKAKRKGRIFIDWLRNQRGGTAI
LPYSARARTGAPIAVPVGWDELKDIETANSFSIRDAADLLERSRSKPLRGWGFAAQSLPE
TI
NT seq 2529 nt NT seq  +upstreamnt  +downstreamnt
atggccagcgccgatccgctttcgcgctacaacgagaagcgggatttcacgcgtacatcc
gaacccgcaggcaagaccgggcgcagcacggatggcaaccttttcatcgttcaaaagcat
ggcgccacgcgccttcattgggattttcgtctggaggcagacggcgtgctcaagagttgg
gccatcacgaaaggcccaagcaccgaccccgacgacaagcgcctcgcggtgcgtaccgag
gatcacccgctctcttacgcgcggttcgaagggacaatacccaagggcgaatatggcggc
ggcaccgtcatgctctgggatcagggcacatgggaacccgtggagggcaagagtgcgaag
gatatcgagaaaggccatctccacttccgcctccatggcgagcgcatgaaaggcgaatgg
ttgctggtgcggatgcgcccgcgccccggcgaaaaacgcgagaactggctgcttcgtaaa
atcgctgatgcctatgccagcaattccgcagatctggtcgagcagggtctcaccagcgtg
ctgacggggcggtcgatggcgcagatcgcggcggataaagcgggaacgcaccccctgcaa
aacaagaaaggcaaggatttcgacgcggccatgaagaaggcggcgcgccacaatgccggc
ctgcgccctaaaacagcccgcaccagaaaagatgcatcctccgcactaccgacattccag
ccggttcagcttgccacgctggtcgataccatacccaccggcaatggctggatgcatgaa
atcaagttcgacggctatcgcgcgctggtggccgccagcagcagcaaggtgcgcatctac
acacgttcaagcctcgactggacggacaagttcgaaccgcttgcccaacagatagcggcg
ctcgacctgcccccctgcctgatcgacggcgagatcgtcgcttacgacagtcaaggcaat
cccgatttctccgcccttcagaacgtgctgaaacgcggccacggccagcaacaggaaaaa
gaccacctggcttttcacgctttcgatctgctgctgcaggatgggctggacctcaaaccc
cttcccgccatcgaacgcaaggaacggctcgaagccctgcttgcagacagccgcccgcct
gttcatgttgcagaccatgtaatcggcgcaggagaaaagctgttctccgccatgtgcgtg
gccgggcaggaggggatcatcgccaagcgcgtggatgcaccctatcggggagagcgcacc
cgcaactgggtcaaggtcaaatgcacccggcgtcaggaattcgtcatcatcggttggacg
acgagcggtacgcgcggccgggcgttcaaatcgttgctgctggcccagcgtgaaggcgat
gtgctcgtgtacaagggcaaagtcgggacgggtttcaacagcgcgacgatggacgatctt
gccaaccggatagcaacgctgacccgcaagacggccccggcccctgtgccccgcgccgag
gcgcggggtgcgcactgggtgacgccgaaactggtcgccgaggtcgccttcgccgaattc
accgccgagggccgcgtgcgccacggcagcttcatcgcgctgcgcaccgacaagaccgca
caggaagtcaagccggaacgggcgcttgccgccccccaagagacggccgcgatcaggatc
acccatcccgaccgcgtgattttcccggaaaccggcgaaaccaaaggtgatctcgccacc
tattatgagagcatcgcaccgctgatgttaccttttgcagcccatcgaccgatcagcctg
gtacgttgcccgcaaggccgtgcacgcaaatgttttttccagaaacatgacagcggatcg
ttcggcccgcatgtgagccatgtaccgattgccgagaagcatggtggcgttgaagattat
ctctacgtcaccgacacggcgggccttctggcctgtgtccagatgggcacgattgagttc
cacggctggtgcgcgagtaccgcagatgttgagcatcccgatcgcatgatcttcgatctt
gatcccgacgaaggactggatttcgcagaggtgaagcgggcggcacgccaaatccgtcag
catctcgccgatcttggccttgtcagcttcgcgatgctctcgggcggcaaaggtgtacat
gtagtgctcccgcttacgcccgggcacgactgggccgtgcacaaggatttcgcgaagcgc
ttcgccgaggcgcttagcatcgccgagccggaacgtttcaccgcgacaatgagcaaggcc
aaacgcaagggccgcatcttcatcgactggcttcgtaaccagcgcggcggcactgctatt
ctgccctactccgcccgcgctcggacgggggcccccatcgcggtgccggttgggtgggat
gaactgaaggacatcgaaacggcgaacagcttcagcattagggacgcggccgacctgctg
gaacggtctcgcagcaagcccttgagaggctggggtttcgcggcccaaagcttgcccgaa
acaatataa

DBGET integrated database retrieval system