KEGG   Novosphingobium tardaugens: EGO55_13270Help
Entry
EGO55_13270       CDS       T05741                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
ntd  Novosphingobium tardaugens
Pathway
ntd00473  D-Alanine metabolism
ntd00550  Peptidoglycan biosynthesis
ntd01100  Metabolic pathways
ntd01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:ntd00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    EGO55_13270
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    EGO55_13270
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    EGO55_13270
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ntd01011]
    EGO55_13270
Enzymes [BR:ntd01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     EGO55_13270
Peptidoglycan biosynthesis and degradation proteins [BR:ntd01011]
 Precursor biosynthesis
  Amino acid ligase
   EGO55_13270
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 ATP-grasp_4 B12-binding
Motif
Other DBs
NCBI-ProteinID: AZI36802
UniProt: A0A3G8XU69
LinkDB All DBs
Position
2824042..2825046
Genome map
AA seq 334 aa AA seqDB search
MGNSESRQTVTLPKLHVAVLMGGWSNERPVSLMSGEGVATALEERGHRVTRIDMDRDVAA
RLAAAKPDVVFNALHGVPGEDGTVQGMLDLMGIPYTHSGLATSVIAIDKELTKQALVPHG
VPMPGGRIVKSAELYEADPLARPYVLKPVNEGSSVGVAIVTRDSNYGNPIRKDVVGPWQQ
FDELLAEPYIRGHELTTAVIAGPDGPRALTVTELVPKSGFYDFDAKYTDGLTEHVCPAQI
PDNIADLCKSYAVQAHRLLGCKGTSRSDFRWDDEQGEAGLFLLETNTQPGMTPLSLVPEQ
ARYCGMTYGELVEAIIADALDHGNGAGNGGAGTN
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgggaaattcagagagtaggcagaccgtgacgcttccgaaactgcatgtggccgtattg
atgggcggctggtcgaacgaacggccggtttcgctgatgagcggcgagggcgtcgccacg
gcattggaagaacggggccatcgtgtcacccgcatcgatatggatcgcgatgtggccgcg
cgccttgccgcggccaaacccgatgttgtgttcaacgccttgcatggggttccgggcgaa
gacggcacggtgcagggcatgctcgatctcatgggcattccctatacgcattccgggctg
gcgacttcggtcatcgcgattgacaaggaactgaccaagcaggcgctggtcccccatggc
gtgccgatgccgggcggacggattgtgaagagcgcggaactctatgaagccgaccccttg
gcgcggccttatgtgctgaagccggtgaacgaagggtcttcggtcggtgtggcgattgtc
acgcgggattccaactacggcaatcctatccgcaaggatgtggtggggccgtggcagcag
ttcgacgaattgttggccgagccctatatccgggggcatgaactgacgacggcggtgatc
gccgggccggatggcccccgtgcgctgactgtcaccgaactggtgcccaaatcgggcttc
tacgatttcgatgccaagtacaccgatggcctgaccgaacatgtgtgcccggcacagatt
cccgataatattgctgacctgtgcaagagctatgcagtgcaggcgcatcgcctgctcggc
tgcaaggggaccagccgttccgattttcgttgggatgatgaacagggggaggcggggctt
ttcctgttggaaaccaacacacaaccggggatgactccgcttagcctggtaccggaacag
gcaaggtattgcggaatgacatatggtgaactggtcgaagcgatcatcgccgatgctctg
gatcatggcaacggggcaggaaacggaggggcagggactaactga

DBGET integrated database retrieval system