KEGG   Novosphingobium tardaugens: EGO55_13725Help
Entry
EGO55_13725       CDS       T05741                                 

Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
ntd  Novosphingobium tardaugens
Pathway
ntd00071  Fatty acid degradation
ntd00280  Valine, leucine and isoleucine degradation
ntd00281  Geraniol degradation
ntd00310  Lysine degradation
ntd00360  Phenylalanine metabolism
ntd00362  Benzoate degradation
ntd00380  Tryptophan metabolism
ntd00410  beta-Alanine metabolism
ntd00627  Aminobenzoate degradation
ntd00640  Propanoate metabolism
ntd00650  Butanoate metabolism
ntd00903  Limonene and pinene degradation
ntd00930  Caprolactam degradation
ntd01100  Metabolic pathways
ntd01110  Biosynthesis of secondary metabolites
ntd01120  Microbial metabolism in diverse environments
ntd01130  Biosynthesis of antibiotics
ntd01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:ntd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    EGO55_13725
   00650 Butanoate metabolism
    EGO55_13725
  09103 Lipid metabolism
   00071 Fatty acid degradation
    EGO55_13725
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    EGO55_13725
   00310 Lysine degradation
    EGO55_13725
   00360 Phenylalanine metabolism
    EGO55_13725
   00380 Tryptophan metabolism
    EGO55_13725
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    EGO55_13725
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    EGO55_13725
   00281 Geraniol degradation
    EGO55_13725
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    EGO55_13725
   00627 Aminobenzoate degradation
    EGO55_13725
   00930 Caprolactam degradation
    EGO55_13725
Enzymes [BR:ntd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     EGO55_13725
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: AZI36888
UniProt: U2ZRC4
LinkDB All DBs
Position
2917445..2918359
Genome map
AA seq 304 aa AA seqDB search
MNELDRLVETPKADIVYETDEPVRYEVVGPVAHIILNRPQFNNAQNSQMTYALDAAFRRA
VDDDAVRAIVLRGEGKHFSAGHDIGTPGRDVTASWDRVGLFPDHTNKPGVEFLYTREHEV
YLTMCRRWRDVPKPTIAAVQGACVAGGLMLAWVCDIIVATDDAFFQDPVNRMGIPGVEYF
AHGFELPPRIAKEFILLGERLPAERAYNFGMVNRLTTRENLLNDVQQLGEELASRPRLGN
WLTKQALNHVEELRGKRSATDAHFHMHHFAHAQSDLLSSNSLGGMDAKSMAAANKSAAKN
TDSE
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaactggatcgcctggtcgaaacgcccaaggctgatatcgtttacgaaactgac
gagcccgtccgctatgaagtggtcgggccggttgcgcatatcatcctcaaccgcccgcag
tttaacaacgcgcaaaacagccagatgacatatgcgctggatgccgcgtttcgccgtgcc
gttgatgacgatgcggtgcgtgcgatcgtgctgcgtggggaagggaaacacttttccgcc
ggacacgatatcggcacgccgggccgcgatgtgaccgccagttgggaccgggttggcctg
ttccccgatcacaccaacaagccgggtgtcgaattcctctacacgcgtgagcatgaggtc
tacctcaccatgtgccgccggtggcgcgatgtgcccaagccgacgattgccgcggtgcag
ggggcctgcgttgcaggtgggctgatgctggcctgggtctgcgatatcatcgttgcgacc
gatgatgcctttttccaggacccggtgaaccgcatggggattcccggcgtggaatacttt
gcacacggtttcgaactgccgccgcgcatcgccaaggaatttatcctgctgggcgaacgt
cttccggcggaacgggcctacaatttcggcatggtcaatcgtctgaccacgcgtgaaaac
ctgctgaacgatgtgcagcagttgggtgaggagctggccagccgtccgcgtctcggcaac
tggctgaccaagcaggcgcttaatcacgtcgaggaactgcggggcaagcgcagcgccact
gacgctcatttccacatgcatcacttcgcccatgcgcagagcgacctgctctcgtcgaac
agcctcggcggcatggatgcgaagtcgatggccgcagcgaacaagtctgccgccaagaat
acggatagcgaataa

DBGET integrated database retrieval system