KEGG   Neurospora tetrasperma: NEUTE1DRAFT115907Help
Entry
NEUTE1DRAFT115907 CDS       T03451                                 

Gene name
NEUTE1DRAFT_115907
Definition
(RefSeq) manganese superoxide dismutase precursor
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
nte  Neurospora tetrasperma
Pathway
nte04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:nte00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    NEUTE1DRAFT115907 (NEUTE1DRAFT_115907)
Enzymes [BR:nte01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     NEUTE1DRAFT115907 (NEUTE1DRAFT_115907)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-GeneID: 20822895
NCBI-ProteinID: XP_009848050
JGI: Neute_matA2_115907
UniProt: F8MEU2
LinkDB All DBs
Position
Unknown
AA seq 245 aa AA seqDB search
MVNLGSIWQNLLASQAPLQSMTGNATTMAGLATYTLPQLPYAYNALEPYISAQIMELHHS
KHHQTYVTNLNNALKVHVAAIASSDIPAQIAQQPAIKFNGGGHINHSLFWKNLAPAETPE
TNYPEAASSLAAEIEKTWGSFDEFKKAFSAALLGIQGSGWGWLVKESTAEKGRLRIITTK
DQDPVVGGEVPVFGVDMWEHAYYLQYLNGKAAYVENIWKVINWKTAEERFRGSREDAFAD
LKALL
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atggtcaatctaggaagcatttggcaaaaccttctcgcctcgcaagctcctctccagtcc
atgacaggcaacgcaaccaccatggccggcctcgcgacttatacccttccgcagctacca
tatgcctacaatgctctggagccctacatctcagcccagatcatggagcttcaccacagc
aagcaccatcagacttacgtgaccaatctcaacaacgccttgaaagttcacgtcgccgcc
atcgcctctagcgatatccccgcccagatcgcccagcagcccgccatcaagttcaacggc
ggcggccacatcaatcactcgctcttctggaagaacctggcccccgctgagacccccgag
accaactacccggaggcggcttcttcgctggcggccgaaattgagaagacgtggggtagc
tttgacgagttcaagaaggccttctctgctgcgctcttgggcatccagggcagtggctgg
ggttggctcgttaaggagtctactgctgagaagggaaggctgcgtatcattactaccaag
gatcaggatcccgtcgtgggcggtgaggttcctgtgttcggggtggacatgtgggagcat
gcgtactacctccagtacctaaacggaaaggctgcgtatgtcgagaatatctggaaggtg
atcaactggaagacagccgaggagcgcttccggggtagtcgtgaggacgcttttgcggac
ctcaaggctttgctatga

DBGET integrated database retrieval system