KEGG   Neurospora tetrasperma: NEUTE1DRAFT116022Help
Entry
NEUTE1DRAFT116022 CDS       T03451                                 

Gene name
NEUTE1DRAFT_116022
Definition
(RefSeq) hypothetical protein
  KO
K02358  elongation factor Tu
Organism
nte  Neurospora tetrasperma
Brite
Translation factors [BR:nte03012]
 Eukaryotic Type
  Elongation factors
   NEUTE1DRAFT116022 (NEUTE1DRAFT_116022)
 Prokaryotic Type
   NEUTE1DRAFT116022 (NEUTE1DRAFT_116022)
Mitochondrial biogenesis [BR:nte03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    NEUTE1DRAFT116022 (NEUTE1DRAFT_116022)
Exosome [BR:nte04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   NEUTE1DRAFT116022 (NEUTE1DRAFT_116022)
  Exosomal proteins of breast cancer cells
   NEUTE1DRAFT116022 (NEUTE1DRAFT_116022)
  Exosomal proteins of colorectal cancer cells
   NEUTE1DRAFT116022 (NEUTE1DRAFT_116022)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 RsgA_GTPase cobW
Motif
Other DBs
NCBI-GeneID: 20822920
NCBI-ProteinID: XP_009848302
JGI: Neute_matA2_116022
UniProt: F8MBY2
LinkDB All DBs
Position
Unknown
AA seq 437 aa AA seqDB search
MSILRTIAPFMRAARAGASTNPLMTMKSPMLNFNRSYASVFQRTKPHVNIGTIGHVDHGK
TTLSAAITKRQSDKGLASFLDYGSIDKAPEERKRGITISTAHIEYSTDNRHYSHVDCPGH
ADYIKNMITGAASMDGAIIVVAASDGQMPQTREHLLLARQVGIQRIVVFVNKVDAIDDPE
MLELVEMEMRELLSSYGFDGDETPVIMGSALCALEGKRPEIGVEKIDALMQAVDDWIPTP
ERDLDKPFLMSVEDVFSIAGRGTVASGRVERGTLKRDQDVEIVGKGTEIIKTKVTDIETF
KKSCEESRAGDNSGLLLRGIRREDIKRGMVVVAPGSVKAHTKFLVSLYVLSKEEGGRHTG
FQANYRPQMFIRSADESVSLTFPEGTEDADSKIVQPGDNCELVATLCHPIAVEAGQRITV
REGGRTVATGIITRIME
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atgtcgattctcaggacgatcgcccccttcatgagggcggcccgggccggtgccagcacc
aaccctctcatgaccatgaagtctcccatgctcaacttcaaccgctcctacgcctccgtc
ttccagcgtaccaagcctcacgtcaacattggtaccattggtcacgtcgatcacggcaag
accaccctctctgccgccatcaccaagcgccagtccgacaagggcctcgccagcttcctc
gactatggctccattgacaaggcccccgaggagcgcaagcgtggtatcaccatctccact
gcccacatcgagtactcgaccgacaaccgccactactcccacgtcgactgcccgggtcac
gccgattacatcaagaacatgatcactggtgccgcctccatggatggcgccatcattgtc
gtcgctgcttccgatggtcagatgccccagacccgtgagcacttgctcctcgcccgtcag
gtcggtatccagcgcatcgtcgtcttcgtcaacaaggtcgatgccattgacgaccccgag
atgttggagctcgttgagatggagatgcgtgagctcctctccagctacggtttcgacggt
gatgagacccccgtcatcatgggttccgccctctgcgccctcgagggcaagcgccccgaa
atcggtgttgagaagatcgatgccctcatgcaggccgtcgacgactggatccccaccccc
gagcgtgacctcgacaagcccttcctcatgtccgttgaggatgtcttctccatcgccggc
cgtggtaccgtcgcctctggccgtgtcgagcgtggtactctcaagcgcgaccaggatgtc
gagattgtcggcaagggtaccgagatcatcaagaccaaggtcactgatatcgagaccttc
aagaagtcctgcgaggagtcccgcgccggcgacaactccggtctcctcctccgtggtatc
cgccgtgaggacatcaagcgcggcatggtcgttgtcgcccctggctccgtcaaggcccac
accaagttcctcgtctccctctacgtcctctccaaggaggaaggtggtcgtcacaccggc
ttccaggccaactaccgcccccagatgttcatccgctccgccgacgagtccgtctcgctc
accttccccgagggtaccgaggatgccgactccaagatcgtccagcccggtgacaactgc
gagttggttgccactctctgccaccctattgccgtcgaggccggtcagcgtatcaccgtc
cgtgagggtggccgcaccgtcgccactggtatcattacccgcatcatggaataa

DBGET integrated database retrieval system