KEGG   Neurospora tetrasperma: NEUTE1DRAFT117282Help
Entry
NEUTE1DRAFT117282 CDS       T03451                                 

Gene name
NEUTE1DRAFT_117282
Definition
(RefSeq) glucan 1, 4-alpha-glucosidase
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
nte  Neurospora tetrasperma
Pathway
nte00500  Starch and sucrose metabolism
nte01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nte00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    NEUTE1DRAFT117282 (NEUTE1DRAFT_117282)
Enzymes [BR:nte01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     NEUTE1DRAFT117282 (NEUTE1DRAFT_117282)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_15 CBM_20
Motif
Other DBs
NCBI-GeneID: 20823256
NCBI-ProteinID: XP_009851942
JGI: Neute_matA2_117282
UniProt: F8MPM1
LinkDB All DBs
Position
Unknown
AA seq 626 aa AA seqDB search
MHLVSSLLVVGAAFQAVLGLPDPLHEKRHSDIIKRSVDSYIQTETPIAQKNLLCNIGSSG
CRASGAASGVVVASPSKSSPDYWYTWTRDAALVTKLIVDEFTNDYNTTLQNTIQAYAAAQ
AKLQGVSNPSGSLSNGAGLGEPKFMVDLQQFTGAWGRPQRDGPPLRAIALIGYGKWLVSN
GYADTAKSIIWPIVKNDLAYTAQYWNNTGFDLWEEVNSSSFFTIAASHRALVEGSAFAKS
VGSSCSACDAVAPQILCFQQSFWSNSGYIISNFVNYRSGKDINSVLTSIHNFDPAAGCDV
NTFQPCSDRALANHKVVVDSMRFWGVNSGRTAGKAAAVGRYAEDVYYNGNPWYLATLAAA
EQLYDAVYVWKQQGSITVTSTSLAFFKDLVSSVSTGTYSSSSSTYTAIINAVTTYADGFV
DIVAQYTPSDGSLAEQFDKDSGAPLSATHLTWSYASFLSAAARRAGIVPPSWGAASANSL
PGSCAASTVAGSYATATATSFPANLTPASTTVTPPTQTGCAADHEVLVTFNEKVTTSYGQ
TVKLVGSIAALGNWVPASGVSLSANQYSSSNPLWSTTIALPQGTSFTYKYVVVNSDGSVK
WESDPDRSYAVGTDCSSTATLDDTWR
NT seq 1881 nt NT seq  +upstreamnt  +downstreamnt
atgcatcttgtctcttcgctcctcgtcgtgggcgccgcctttcaggccgtgctcggtctg
ccggatcctctgcatgagaagaggcacagcgacatcatcaagcggtctgtcgactcttat
atccagaccgagactcccattgcgcagaagaaccttctgtgcaacattggttcttctgga
tgcagagcctccggtgctgcctctggtgttgtggttgcctccccttccaagtcgagcccc
gactactggtatacctggactcgtgatgccgcccttgtcaccaagcttattgtcgacgaa
ttcaccaacgactacaacaccactcttcagaacaccattcaggcttatgctgctgcacag
gccaagcttcagggcgttagcaacccgtccggttccctctccaacggtgccggtcttggt
gagcccaagttcatggtcgacctccagcagttcaccggtgcctggggccgcccccagagg
gatggtcctccccttcgcgccattgccctcatcggctatggcaagtggctcgtcagcaac
ggttatgctgatactgccaagagcatcatctggcccattgtgaagaacgaccttgcctac
actgcccagtactggaacaacaccggcttcgatctctgggaggaggtcaacagctcttct
ttcttcaccattgccgcctcccaccgtgctctcgttgagggttctgcctttgccaagtcc
gtcggcagctcttgcagcgcttgcgatgccgttgctccccaaattctgtgcttccagcag
agcttctggtccaacagcggctacatcatctccaactttgtcaactaccgcagcggcaag
gacatcaactccgtcttgacttccatccacaacttcgaccccgctgccggttgcgatgtc
aacaccttccagccctgcagcgaccgtgctcttgccaaccacaaggttgtcgttgactcc
atgcgcttttggggtgtcaactccggtcgcactgccggtaaggccgccgctgtcggtcgc
tacgccgaggatgtctactacaacggtaacccctggtacctcgccactctcgccgccgcc
gagcagctctacgacgccgtctacgtctggaagcagcagggttccatcaccgtcacctcc
acttccctcgccttcttcaaggacctcgtctcctccgtcagcaccggcacctactccagc
tcctcctctacctacaccgccatcatcaacgccgtcaccacctatgccgacggcttcgtc
gacatcgttgcccagtacactccctccgacggctccctggccgagcagttcgacaaggac
tcgggcgcccccctcagcgccacccacctgacctggtcgtacgcctccttcctttccgct
gccgcccgccgcgccggcatcgtccctccctcgtggggcgccgcgtccgccaactctctg
cccggttcctgcgccgcttccaccgtcgccggttcctacgccaccgcgactgccacctcc
tttcccgccaacctcacgcccgccagcaccaccgtcacccctcccacgcagaccggctgc
gccgccgaccacgaggttttggtaaccttcaacgagaaggtcaccaccagctatggccag
acggtcaagctcgtcggcagcatcgctgcgctcggcaactgggtccccgctagcggcgtc
agcctgtcggctaaccagtactcttctagcaacccgctttggtccaccactattgcgctg
ccccagggcacctcgttcacgtacaagtatgtcgtcgtcaactcggatggatccgtcaag
tgggagagcgatcctgaccgcagctatgctgttgggacggactgctcctctactgcgact
cttgatgatacgtggaggtaa

DBGET integrated database retrieval system