KEGG   Neurospora tetrasperma: NEUTE1DRAFT117950Help
Entry
NEUTE1DRAFT117950 CDS       T03451                                 

Gene name
NEUTE1DRAFT_117950
Definition
(RefSeq) hypothetical protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
nte  Neurospora tetrasperma
Pathway
nte00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:nte00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    NEUTE1DRAFT117950 (NEUTE1DRAFT_117950)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:nte02000]
    NEUTE1DRAFT117950 (NEUTE1DRAFT_117950)
Enzymes [BR:nte01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     NEUTE1DRAFT117950 (NEUTE1DRAFT_117950)
Transporters [BR:nte02000]
 Other Transporters
  Pores ion channels [TC:1]
   NEUTE1DRAFT117950 (NEUTE1DRAFT_117950)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N GST_N_3 GST_C GST_N_2 GST_C_2 GST_C_3 Tom37
Motif
Other DBs
NCBI-GeneID: 20823434
NCBI-ProteinID: XP_009853664
JGI: Neute_matA2_117950
UniProt: F8MSF4
LinkDB All DBs
Position
Unknown
AA seq 236 aa AA seqDB search
MADSSSLKPIKVYGHTGPNPPKVIMVLAELGIPYDLDNIQISQAKSPEFVKNVNPNGRLP
AIQDPNTDLTLWESGAILEYLTEKYDKELKLSFTPGTNDFYLARQWLYFQTTGQGPYYGQ
VAWFKRYHPEPVPSAVERYVKELNRVSSVMEDHLQTQKEKYGTEEPWFVGNKFSYVDIAF
APWQHIVGVMLTKEEYDEDKYPLIHAWLERLRARKPIKEALDNMIPAGGAPPKQNE
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atggcggactcctcttccctcaagcccatcaaggtctacggccacaccggccccaacccg
cccaaggtgatcatggtccttgccgagctcggcattccctatgacctggacaacatccaa
atctcccaggccaagagccccgagttcgtcaagaacgtcaaccccaacggccgcctgccc
gccatccaggaccccaacacggacctcaccctctgggagtccggtgcgatcctcgagtac
ctgaccgagaagtacgacaaggagctcaagctcagcttcacccctggcaccaacgacttc
tacctcgcccgccagtggctctacttccagaccacgggccagggcccctactacggccag
gtcgcgtggttcaagagataccacccggagccggtgcccagcgccgttgagagatatgtc
aaggagctgaaccgcgtgtcgagcgtgatggaggaccacttgcagacgcagaaggagaag
tacggcaccgaggagccgtggtttgtgggcaacaagttcagctatgtcgacattgcgttt
gcgccgtggcagcacattgtcggcgtgatgctgaccaaggaggagtatgacgaggacaag
tacccgttgattcacgcctggttggagaggttgagggcgaggaagcccatcaaggaggct
ttggataacatgattcctgctggtggcgctcctcctaagcagaacgagtaa

DBGET integrated database retrieval system