KEGG   Neurospora tetrasperma: NEUTE1DRAFT119084Help
Entry
NEUTE1DRAFT119084 CDS       T03451                                 

Gene name
NEUTE1DRAFT_119084
Definition
(RefSeq) hexokinase
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
nte  Neurospora tetrasperma
Pathway
nte00010  Glycolysis / Gluconeogenesis
nte00051  Fructose and mannose metabolism
nte00052  Galactose metabolism
nte00500  Starch and sucrose metabolism
nte00520  Amino sugar and nucleotide sugar metabolism
nte01100  Metabolic pathways
nte01110  Biosynthesis of secondary metabolites
nte01130  Biosynthesis of antibiotics
nte01200  Carbon metabolism
Module
nte_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
nte_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:nte00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NEUTE1DRAFT119084 (NEUTE1DRAFT_119084)
   00051 Fructose and mannose metabolism
    NEUTE1DRAFT119084 (NEUTE1DRAFT_119084)
   00052 Galactose metabolism
    NEUTE1DRAFT119084 (NEUTE1DRAFT_119084)
   00500 Starch and sucrose metabolism
    NEUTE1DRAFT119084 (NEUTE1DRAFT_119084)
   00520 Amino sugar and nucleotide sugar metabolism
    NEUTE1DRAFT119084 (NEUTE1DRAFT_119084)
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    NEUTE1DRAFT119084 (NEUTE1DRAFT_119084)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:nte04131]
    NEUTE1DRAFT119084 (NEUTE1DRAFT_119084)
Enzymes [BR:nte01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     NEUTE1DRAFT119084 (NEUTE1DRAFT_119084)
Membrane trafficking [BR:nte04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    NEUTE1DRAFT119084 (NEUTE1DRAFT_119084)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1 FGGY_N
Motif
Other DBs
NCBI-GeneID: 20823740
NCBI-ProteinID: XP_009856748
JGI: Neute_matA2_119084
UniProt: F8N1E6
LinkDB All DBs
Position
Unknown
AA seq 501 aa AA seqDB search
MVGLGPKPPFPRKGTGTLDNLPKDLRNEIEHLERLFTVDGAKLKEVTNHFVHELEKGLSV
QGGSIPMNPTWVMSFPDGNETGTYLALDMGGTNLRVCQVTLTETKSEFDIIQSKYRMPEE
LKTGDAEELWEYIADCLMQFIETHHGDPTKLDALPLGFTFSYPATQNYIDEGILQRWTKG
FDIAGVEGHNVVPMFEAALQRRGVPIKLTALINDTTGTLIASAYTDPKMRIGCIFGTGCN
AAYMENCGSIPKLAHMNLPPDMPMAINCEWGAFDNEHKVLPRTPYDVIIDKDSPRPGQQS
FEKMVAGLYLGEIFRLVLVDLHDNQEIKIFPGQDIAKLRKAYSLDSSFLSLIEEDPFENL
SETFELFQTKLGLTPTGPELELIRRTAELIGTRAARLSACGVAAISKKKGYKQCHVGADG
SVFNKYPNFKARGAQALREILDWPEKADPKEDDPIEILAAEDGSGVGAALIAALTMQRIK
QGNMHGILHPENFRTTEPLPA
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atggttggacttggacccaagcctccctttcccagaaagggcaccgggactctcgataac
cttcctaaggatctccgcaatgagatcgagcacctcgagcgcctctttaccgtcgatggc
gccaagctcaaggaagttaccaaccacttcgtccatgagctcgagaaaggccttagcgtc
cagggagggagcattcccatgaacccaacctgggttatgtccttccccgacggtaacgaa
accggcacttatctggctttggacatgggtggtacaaacctacgtgtctgccaagtcact
ttgaccgaaacaaagtccgaattcgacatcatccagtccaagtaccgcatgcccgaggag
ctcaagacgggcgacgccgaggagctgtgggagtacattgccgactgcctcatgcaattc
attgaaacgcaccacggagacccaaccaagctcgatgcgcttccactcggttttactttc
tcctatccggcgacacagaactatatcgacgagggcattctgcaacgctggaccaagggc
ttcgatatcgctggcgtagagggccataatgttgtccccatgtttgaggctgccctccag
cgccggggagtgcctatcaagctgacggcgttgatcaacgacactacaggcaccctgatt
gcctcggcatacactgatcctaagatgagaattggatgcatttttggcacaggttgcaat
gctgcgtacatggagaactgtggctcgattcccaagctcgctcatatgaatctcccaccg
gatatgccaatggccatcaactgcgaatggggagcttttgacaacgagcataaggtcttg
cctcgtactccttacgacgtcattattgacaaggattcgccgcgtcctggtcagcagtcc
ttcgagaagatggtcgcaggattgtatctgggtgaaatcttccgccttgtcttggttgac
ctccacgacaaccaggagatcaagatcttccctggccaggatatcgccaagcttcggaaa
gcttatagtcttgactcgtccttcctctccctcattgaagaggatccgttcgagaacctt
tccgaaacctttgagctgttccagactaagctgggacttacacccaccggccccgaattg
gagctgattcgtcgcaccgccgagctaatcggtacccgcgccgctcgcctctccgcctgc
ggcgttgctgccatcagcaagaagaaaggatataagcagtgccacgttggtgctgatgga
tccgttttcaacaagtatcccaacttcaaggctcgtggcgcgcaagcactccgtgagatc
ctggactggcctgagaaggcggaccccaaggaagatgatccgatcgagattctcgccgcc
gaggacggaagcggtgttggtgctgctttgatcgctgccctgacgatgcaacggatcaag
caaggaaatatgcacggtatcctgcacccagagaacttcagaactaccgagcctctgcct
gcgtga

DBGET integrated database retrieval system