KEGG   Neurospora tetrasperma: NEUTE1DRAFT131658Help
Entry
NEUTE1DRAFT131658 CDS       T03451                                 

Gene name
NEUTE1DRAFT_131658
Definition
(RefSeq) hypothetical protein
  KO
K18102  L-galactonate dehydratase [EC:4.2.1.146]
Organism
nte  Neurospora tetrasperma
Pathway
nte00040  Pentose and glucuronate interconversions
nte01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nte00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    NEUTE1DRAFT131658 (NEUTE1DRAFT_131658)
Enzymes [BR:nte01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.146  L-galactonate dehydratase
     NEUTE1DRAFT131658 (NEUTE1DRAFT_131658)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MR_MLE_C MR_MLE_N MAAL_C
Motif
Other DBs
NCBI-GeneID: 20825559
NCBI-ProteinID: XP_009853986
JGI: Neute_matA2_131658
UniProt: F8MVS6
LinkDB All DBs
Position
Unknown
AA seq 451 aa AA seqDB search
MSDQEITITGWTTRDVRFPTSLDKTGSDAMNAAGDYSAAYCILQTDSKYTGHGMTFTIGR
GNDIVCSAINHVADRIRGRTLSSLVSNWGQTWRHLVNDSQLRWIGPEKGVIHLALGAVVN
ALWDLWAKVLGKPVWRIVSEMSPDEFVRCIDFRYITDAITPEEAVEMLKETEKTKTERIK
DAEANRAVPAYTTSAGWLGYGEDKMRALLRETMEKGYKHFKLKVGGSVEQDKRRLGIARE
VIGYDKGNVLMVDANQVWSVPEAIEYMKELKEFKPWFIEEPTSPDDILGHKAIREALKEY
GIGVATGEMCQNRVVFKQLLMSGAIDVCQIDACRMGGVNEVLAVLLIAKKYGVPIVPHSG
GVGLPEYTQHLSTIDYVVVSGKKSVLEYVDHLHEHFLYPSVIKDGYYQTPTEPGYSVEMK
ADSMDRFEYPGGEKSWWRTEEAKPILEGPKF
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atgtccgaccaagaaatcacaataacgggctggaccacccgcgatgtccgcttccccacc
tctctcgacaagacgggttccgacgccatgaacgccgcaggcgactactcggccgcttac
tgcattctccagactgattccaagtataccggacatggcatgaccttcaccatcggccgc
ggcaacgacatcgtctgctccgccatcaaccacgtcgccgaccgcatccgcggccgcacc
ctctcctctctcgtgtccaactggggccaaacctggcgccacctcgtcaacgactcgcaa
ctgcgctggatcggcccagaaaagggcgtgatccacctcgccttgggcgccgtcgtcaac
gccctctgggacctatgggccaaagtgctgggcaaacccgtgtggcggatcgtctccgaa
atgtcgcccgacgagtttgtacggtgtattgattttcggtacatcacggacgccatcact
cctgaagaggcagtggagatgttgaaggagactgaaaagaccaagaccgaaagaatcaaa
gacgcggaggcgaatagggccgtgccggcgtatacgacgagtgcggggtggttggggtac
ggggaggataagatgagggcgttgttaagggagacgatggagaaggggtacaagcatttc
aagctcaaggtgggcggtagtgttgagcaggataagagacggctggggatcgcgagggag
gtgattgggtatgataaggggaatgtcctgatggtggatgcaaaccaggtctggagcgtg
ccggaggcgattgagtacatgaaggagctgaaggagtttaagccgtggttcattgaggag
ccgacgagcccggatgatattttgggtcacaaggcgatcagggaggcgctgaaggagtat
gggattggggtggctacgggcgagatgtgtcagaacagggtggtgttcaagcagctgttg
atgagcggggcgattgatgtgtgccagattgatgcgtgccggatgggaggcgtcaatgag
gtgttggcggtgttgctgattgcgaagaagtatggcgtgccgatcgtgccgcattcgggc
ggtgttgggttgcctgagtatacgcagcacttgagcacgatcgactatgtggtggtgagc
gggaagaagtcggtgttggagtatgtggatcatcttcatgagcactttttgtatccgtcg
gtcatcaaggatgggtactatcagacccccaccgagcctgggtattccgtggagatgaag
gcggacagcatggatcggttcgagtatcctggtggtgagaaaagctggtggaggactgag
gaggccaagcctattctcgagggacccaagttctag

DBGET integrated database retrieval system