KEGG   Neurospora tetrasperma: NEUTE1DRAFT133882Help
Entry
NEUTE1DRAFT133882 CDS       T03451                                 

Gene name
NEUTE1DRAFT_133882
Definition
(RefSeq) hypothetical protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
nte  Neurospora tetrasperma
Pathway
nte00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:nte00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    NEUTE1DRAFT133882 (NEUTE1DRAFT_133882)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:nte02000]
    NEUTE1DRAFT133882 (NEUTE1DRAFT_133882)
Enzymes [BR:nte01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     NEUTE1DRAFT133882 (NEUTE1DRAFT_133882)
Transporters [BR:nte02000]
 Other Transporters
  Pores ion channels [TC:1]
   NEUTE1DRAFT133882 (NEUTE1DRAFT_133882)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_2 GST_N_3 GST_C_2 GST_N GST_C GST_C_3 GST_C_5
Motif
Other DBs
NCBI-GeneID: 20825787
NCBI-ProteinID: XP_009857115
JGI: Neute_matA2_133882
UniProt: F8N479
LinkDB All DBs
Position
Unknown
AA seq 438 aa AA seqDB search
MPRQVDSYFELLGHDIIHGAGWEPTTRVPRADKTAPLPEPEHGLAIPGLPASGGSCQGLT
RGPEAGQGHGSKNPKLDTLLSALTYLHVPTLSKLPRTLSSSTRTPFVLKLNTRSLPVPVQ
VHHCTMSSSSSSNPSTQKPASVDTSLQGSPTGAAALFASSHSSPHPLKLYGGWFCPFVQR
VWITLAEKNIPHQYIEINPYHKAPEFLALNPRGLVPTLAVPTSTDPKTGKVKEVKPLYES
LVLCEYLDEAYTDENTYGDRLLPQDDAYERARCRLWIDHISSRVVPAFYRFIQHTPDKPY
TIDEIRTEFHGHLKAFAKEMLDASSPSSSPGPFFLGDKFSLVDIMLAPWAKRLFLIDHYK
PGGVGIPPSGQRGSEVDEEIWKRWEEWYKAVTERDSVKKTWSEDEQYVGAYKRYAEDTTQ
SEVGRATRRAGFTLSTRV
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgcctcgccaagttgacagctacttcgagctgcttggtcacgacatcatccacggcgcc
ggttgggagccgaccacccgtgtcccacgcgccgacaaaaccgcccccctgcctgagccc
gagcacggtcttgctataccgggactgcccgccagtggaggttcgtgccagggtctcact
aggggtcctgaagcaggacagggtcacggttccaagaaccccaagcttgataccctcctt
tccgccttgacctacctccatgtgccaacgctttccaagctcccgcgaactctcagctcc
tccactagaaccccatttgtcctgaagctcaacacaagatcgctcccggtccccgttcaa
gtccaccattgtaccatgtcctcctcctcctcctctaacccctccacccaaaagccggct
tcggtcgacacctccctccaaggctcgcccaccggcgccgccgcgctcttcgcttcctcg
cactcttctccacaccccctcaagctctacggcgggtggttctgtcccttcgtccagcga
gtctggatcaccctcgccgagaaaaacattccgcaccaatacatcgagatcaacccgtac
cacaaagcgcccgagttcctcgctctcaacccacggggtcttgtgcccaccctcgcagtc
cccacctccaccgaccccaagaccggaaaggtgaaggaggttaagcccttgtacgagagc
ttggtgctttgcgagtatctggatgaggcgtatacggatgagaacacgtacggggaccga
ctcctcccgcaagacgacgcctacgaaagggcgaggtgcagactgtggatcgaccatatc
tcttcgagggtggtaccggctttttaccggtttattcagcacacccccgacaaaccctac
accatcgacgagatccgaaccgagttccacggacacctgaaagcgttcgctaaagaaatg
cttgatgcctcttccccttcttcctccccaggccccttcttcctaggcgacaagtttagt
ctagtagacataatgctagcgccttgggcgaagcggttattcctgatcgatcattacaaa
ccaggcggagttgggatccctcccagtggtcagaggggaagtgaggtggatgaggagatc
tggaagaggtgggaggagtggtacaaggctgtgacggagagggacagtgtcaagaagacg
tggagcgaggatgaacagtatgtgggcgcgtataagaggtatgcggaggatacgacacag
agtgaagtggggagggcgacgaggagggcggggtttaccttgagtacaagagtttga

DBGET integrated database retrieval system