KEGG   Neurospora tetrasperma: NEUTE1DRAFT139259Help
Entry
NEUTE1DRAFT139259 CDS       T03451                                 

Gene name
NEUTE1DRAFT_139259
Definition
(RefSeq) hypothetical protein
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
nte  Neurospora tetrasperma
Pathway
nte00052  Galactose metabolism
nte00500  Starch and sucrose metabolism
nte01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nte00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    NEUTE1DRAFT139259 (NEUTE1DRAFT_139259)
   00500 Starch and sucrose metabolism
    NEUTE1DRAFT139259 (NEUTE1DRAFT_139259)
Enzymes [BR:nte01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     NEUTE1DRAFT139259 (NEUTE1DRAFT_139259)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 20826089
NCBI-ProteinID: XP_009852870
JGI: Neute_matA2_139259
UniProt: F8MRY4
LinkDB All DBs
Position
Unknown
AA seq 854 aa AA seqDB search
MIRMPKPALALLSLFSIASAAPLATCPGYRVTNAQSGPSYLVADLTLAGTNCNLYSEDIT
NLRLTVEYQTDTRLHVLIADREQNVYQIQDNILPRPLSQNASSQTADLRFTYEAYPFSFK
VTRASTGDVLFDTSPSPLIFETQYLRLRTRLPPNPNLYGLGEHSDSFRLATDGYKRTLWN
SEAPYIPQNQNLYGSHPVYFEHRGGNGTGGTHGVFLRSAAGMDVVIGKSDAGEQYLEYNT
IGGVLDFYFLAGPGPEEVSKQYAEVVGLPAMMPYWSLGFHQCKYGWPDLGHVKQVVKNYS
DAGIPLEALWDDIDYMDNKLDFSTDPVRYPHDQLKGFVDELHGKDMRYVQILDPGIRYKS
DYGPFTRGAEKDVFLKAADGSWYRGLQWPGEVVWPDWIAPQTKEWWTTEILTFYDPNNGI
NADGLWVDMNEASNMCADTTCLSSGQKTRSLPQSLIGKIHPRAPGDGQHLGLPNRDLFTP
KYQIANHYPTLSSRTLFTNITNSDGSAQYDTHNLYALTMSSVSRSALISRSPTKRPFLLT
RSTFSGSSRFAAHWFGDNFSSWADYRASIRQLLSFSAIHNYPMVGSDVCGFNGQAQENMC
ARWAVLGAWQPFYRNHADISAPDQEFYRWPSVAAAARKAISVRYRLLDYIYTGLYYASKT
GEPALVKPLWFLFPSDPATYGIDTQFFLGDALLVSPVVEDDAQSVTFYLPQGKWYDFFTH
HRIDQTSAGGRNVTVSGVGWDQIPVYIRGGSILALRLSDASFTTGQAMTTAEVRTRNFEI
VIAPDQNGKAKGRLYLDDGESLDSRGKESEIEFIWDGTKLEVKGTFGYDTKGVVVQRIVL
LDDGVSGNEQRETS
NT seq 2565 nt NT seq  +upstreamnt  +downstreamnt
atgatcaggatgcccaaacccgcccttgcgctgctgtcgctcttctcgatagcatccgcg
gcgcctctggcaacttgcccaggataccgagtcaccaacgcccaatctgggccttcgtat
ctcgtcgccgacctaactctcgccggcaccaactgcaatctctacagcgaagatattacc
aacttgcgcctgaccgtggaataccagaccgacacccgcctacacgtcttgatcgcagac
cgcgagcaaaacgtctaccagatccaagacaacatcctaccacggcctctctcacaaaat
gcctcctcccaaaccgccgatcttcgctttacctacgaagcctaccccttctccttcaag
gttacacgcgccagcaccggcgacgtccttttcgatacttctccatcgccattgatcttt
gagacgcaatacctccgcttacgcacgcgcctgcctccgaacccgaatctgtacgggctg
ggagaacactcagattctttccggttggcgacagatgggtacaaaagaacgttgtggaac
tccgaggcgccctacataccgcaaaaccagaacttgtacgggagtcatcctgtttacttt
gagcaccgcggtggcaatggtacgggagggacgcatggagttttcttgagaagcgcagcg
gggatggacgtcgtgattggaaagagtgatgccggagagcaatacctcgagtataacacc
attgggggagtgcttgacttttatttcctggccggaccgggtccagaggaagtgagcaag
cagtatgccgaagttgttggtctccccgcaatgatgccgtattggtcgctaggatttcac
cagtgtaaatacggctggccggatctggggcatgtcaagcaggttgtcaagaactatagc
gatgcaggaattccgttggaggccctttgggacgatatcgattatatggacaacaagctg
gattttagtacggatccagtgcggtatcctcatgaccagctgaaggggtttgtggacgaa
ctgcacgggaaagatatgcggtatgtgcagattctggatccgggaatcaggtacaagagc
gactatggcccgtttaccaggggtgccgagaaggatgtgtttctcaaggcggctgatggg
tcctggtatcgtggcctgcagtggcctggggaggtggtctggccggattggattgcgccg
cagacaaaggagtggtggacgacagagattctgacattttatgatccgaataatgggatc
aatgcggacgggctgtgggttgacatgaatgaggcgagcaacatgtgtgcggacactact
tgtctctcttcaggtcagaaaactcgctccctgcctcagtctttaatcggcaaaatccat
ccacgcgccccaggcgatggacaacacctcggcctccccaaccgcgacctcttcaccccc
aagtaccagatagcgaaccactaccccaccctttccagccgcaccctgttcaccaacatc
accaactcggacggctcagcgcaatacgacacccataatctctacgccctcaccatgtcc
tccgtctctcgctccgccctcatctcccgctcgcccaccaaacgccccttcctcctcacc
cgttccaccttttcgggatcttcccgcttcgccgctcactggttcggcgacaacttttct
tcctgggccgactaccgcgcctcaatccggcagctcctcagcttcagcgccatacacaac
taccccatggtgggctccgacgtctgtggcttcaacggccaggcccaagagaacatgtgt
gcacgctgggcagttctcggcgcttggcagcccttttaccgcaaccacgccgacatctcc
gctcccgaccaggaattctatcgatggccttcagtcgccgctgccgcgcgcaaagcgatt
agtgtcaggtaccgactgctggattacatctacacaggcctttactacgccagcaaaaca
ggtgaaccggcactagtcaaaccgctctggttcctcttcccctccgacccggcaacatac
ggcatcgacacgcaattcttcctcggcgacgcattgcttgtttctcccgtggtagaagac
gacgcccaatccgtcactttttacttgcctcaagggaaatggtacgatttctttacgcat
caccggattgatcagacttccgctggtggccgaaacgttactgtgtcgggagtaggttgg
gatcagatccctgtttatattcgtggcggaagtatcttggccctccgcctttctgacgct
tcgtttacgaccggacaggcaatgaccactgccgaagtccggacgcggaactttgagatc
gttattgcccctgatcagaacggcaaagcgaaggggagactgtacttggatgatggcgag
agcttggattcgagagggaaggagagtgagattgagtttatctgggatggaacaaagtta
gaggtgaaggggacgtttgggtatgatacgaagggggtggtggtgcagagaatagtgctt
ttggatgatggggttagtgggaatgagcagagggagacttcctag

DBGET integrated database retrieval system