KEGG   Neurospora tetrasperma: NEUTE1DRAFT49798Help
Entry
NEUTE1DRAFT49798  CDS       T03451                                 

Gene name
NEUTE1DRAFT_49798
Definition
(RefSeq) hypothetical protein
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
nte  Neurospora tetrasperma
Pathway
nte00020  Citrate cycle (TCA cycle)
nte00480  Glutathione metabolism
nte01100  Metabolic pathways
nte01110  Biosynthesis of secondary metabolites
nte01130  Biosynthesis of antibiotics
nte01200  Carbon metabolism
nte01210  2-Oxocarboxylic acid metabolism
nte01230  Biosynthesis of amino acids
nte04146  Peroxisome
Module
nte_M00009  Citrate cycle (TCA cycle, Krebs cycle)
nte_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:nte00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    NEUTE1DRAFT49798 (NEUTE1DRAFT_49798)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    NEUTE1DRAFT49798 (NEUTE1DRAFT_49798)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    NEUTE1DRAFT49798 (NEUTE1DRAFT_49798)
Enzymes [BR:nte01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     NEUTE1DRAFT49798 (NEUTE1DRAFT_49798)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-GeneID: 20828232
NCBI-ProteinID: XP_009853884
JGI: Neute_matA2_49798
UniProt: F8MV05
LinkDB All DBs
Position
Unknown
AA seq 462 aa AA seqDB search
MSPVTANLIRSSLRQASVYSRLNIATAPAFTRPAAPSLFVSNNRFRTMASEAFQKIKVKN
PVVELDGDEMTRIIWQDIKEKFIYPFLDIDLKYYDLGLEYRDQTNDQVTIDAAEAIKKYS
VGVKCATITPDEARVEEFKLKQMWLSPNGTIRNALGGTVFREPIVIPRVPRLVPGWKKPI
IIGRHAFGDQYRAKDLVAPGPGKLQMVYTPEGGEPQVIDVFDYKNGGGVAQTQYNTDESI
EGFAHASFKLALDKGLPLYMSTKNTILKKYDGRFKDIFQQIYDTQYKEAFEAKKIWYEHR
LIDDMVAQMIKSSGGYIMALKNYDGDVQSDIVAQGFGSLGLMTSVLITPDGKTFESEAAH
GTVTRHYREHQKGNQTSTNPIASIFAWTRGLVQRGKLDNTPELIAFAEALEKACIDTVDI
DGIMTKDLALACGKTGREDWVTTSEYMAAVERRLKSTLKEKL
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcccgtcaccgcaaacctcatccgctcctccctccgtcaggcttctgtctactcc
cgtctcaacatcgccactgctcctgcctttactcgccctgctgccccttccctcttcgtc
tccaataacagattccgcacaatggcttccgaggctttccagaagatcaaggtcaagaac
cccgtcgtcgagctcgatggcgatgagatgacccgcatcatctggcaggacatcaaggag
aagttcatttaccccttccttgacatcgacctcaagtactatgacttgggtctcgagtac
cgtgaccagaccaacgaccaggtcactattgatgccgccgaggccatcaagaagtactcc
gtcggtgttaagtgcgctaccatcactcccgatgaggctcgtgtagaggagttcaagctc
aagcagatgtggctgtcccccaacggcaccatccgcaatgctctcggtggcactgttttc
cgtgagcccatcgtcattccccgcgtccctcgcctggtgcccggctggaagaagcccatc
attattggccgccacgcctttggtgaccagtaccgcgccaaggacctcgtcgctcccggc
cccggtaagctccagatggtctacacccccgagggtggtgagccccaggtcatcgacgtc
ttcgactacaagaacggcggcggtgttgcccagacccaatacaacactgatgagtccatc
gagggcttcgcccacgcttccttcaagcttgctcttgacaagggtcttcccctctacatg
agcaccaagaacaccatcctcaagaagtacgatggccgcttcaaggatatcttccagcag
atctacgacacccagtacaaggaggctttcgaggccaagaagatctggtacgagcaccgt
ctcatcgacgacatggtcgcccagatgatcaagagctccggtggctacatcatggccctc
aagaactatgatggtgatgtccagtccgatatcgttgctcagggcttcggctccctcggt
ctcatgacctccgtcctcatcacccccgatggtaagaccttcgagtccgaggctgcccac
ggtaccgtcactcgccactaccgcgagcaccagaagggtaaccagacctccaccaacccc
attgcctccatcttcgcctggacccgtggtcttgtccagcgtggcaagctcgacaacact
cccgagctcattgctttcgctgaggctctcgagaaggcctgcattgacaccgtcgatatc
gatggcatcatgaccaaggatctcgcgcttgcctgcggcaagaccggccgtgaggattgg
gtcaccacctccgagtacatggctgccgtcgagcgccgcctcaagagcactctcaaggag
aagctctaa

DBGET integrated database retrieval system