KEGG   Neurospora tetrasperma: NEUTE1DRAFT57176Help
Entry
NEUTE1DRAFT57176  CDS       T03451                                 

Gene name
NEUTE1DRAFT_57176
Definition
(RefSeq) glycogen synthase
  KO
K00693  glycogen synthase [EC:2.4.1.11]
Organism
nte  Neurospora tetrasperma
Pathway
nte00500  Starch and sucrose metabolism
nte01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nte00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    NEUTE1DRAFT57176 (NEUTE1DRAFT_57176)
Enzymes [BR:nte01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     NEUTE1DRAFT57176 (NEUTE1DRAFT_57176)
Glycosyltransferases [BR:nte01003]
 Polysaccharide
  Storage polysaccharide
   NEUTE1DRAFT57176 (NEUTE1DRAFT_57176)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycogen_syn Glyco_transf_4 Glyco_transf_5 Glycos_transf_1 Glyco_trans_1_4 Glyco_trans_4_4
Motif
Other DBs
NCBI-GeneID: 20828591
NCBI-ProteinID: XP_009847278
JGI: Neute_matA2_57176
UniProt: F8MDA2
LinkDB All DBs
Position
Unknown
AA seq 706 aa AA seqDB search
MAHDNREPREVKNHLLFEVATEVAHRVGGIYSVLKSKAPVTTAEYGDRYTLIGPLNHQSA
AVEVEELEPSNPELKATIQAMRDRGIGILYGRWLIEGAPRVLLFDTKTAYGYMNEWKTDL
WNVASIPSPDNDEETNEAIVFGYLVAWFLGEFVCHEKRKAVIAHFHEWLAGVALPLTKKR
QIDVTTIFTTHATLLGRYLCAGSVDFYNNLQWFDVDAEAGKRGIYHRYCIERAAAHSCDV
FTTVSHITAYESEHLLKRKPDGVLPNGLNVTKFSAMHEFQNLHQQNKEKIHDFVRGHFYG
HYDFEPENTLYFFTAGRYEFRNKGVDMFIESLARLNHRLKTAGSKTTVVAFIIMPAQTTS
LTVEALKGQAVIKSLRDTVDVIERGIGRRIFERSVKWHEGDPLPEEKELITSQDRVLLRR
RLFAMKRHTLPPIVTHNMLNDHEDPILNQIRRVQLFNHPSDRVKIVFHPEFLSSANPVLP
LDYDDFVRGTHLGVFASYYEPWGYTPAECTVMGVPSITTNLSGFGCYMEELIENSSDYGI
YIVDRRSKGVDDSVNQLTQYMFEFTQKSRRQRINQRNRTERLSDLLDWKRMGMEYVKARQ
LALRRAYPTSFNGEEEEDFIPGVEQKISRPFSVPGSPRDRTGMMTPGDFASLQESHEGLS
TEDYVAWKLPEEEDPEEYPFPLTLKQRTGPGSPLDSIQGLQLNGTR
NT seq 2121 nt NT seq  +upstreamnt  +downstreamnt
atggcccacgacaaccgtgaaccccgcgaggtcaaaaaccacctcctctttgaggtggcg
accgaggtcgcccatcgagttggtggaatctactccgttctcaagtcgaaagctccagtt
acaaccgctgaatatggcgaccgttacactcttatcggtcccctgaaccaccaatcggcg
gccgtcgaggttgaagagctagagccatccaaccccgaactaaaggcgacgattcaggcc
atgagagaccgtggcatcggcattctttacggacgatggctcattgagggagctcccaga
gtgttgctcttcgatacaaagaccgcttacggttacatgaacgagtggaagacggacctc
tggaatgttgcttccatcccatctccggacaacgacgaagagacgaacgaggccattgtc
ttcggttacctggtcgcatggttcctgggcgagtttgtatgccatgagaagagaaaggcc
gtcatcgcccacttccacgaatggcttgccggtgtcgcgctgccattgaccaagaagagg
cagattgacgttaccaccatcttcacgacacatgccactcttctcggtcgctatttgtgc
gccggctcagtagacttctacaacaaccttcagtggtttgacgttgacgccgaggctgga
aagcgcggaatctatcatagatactgcatcgagcgagctgccgcccattcctgcgatgtc
ttcaccaccgtttcccacatcacagcttacgagagtgagcatttgctcaagcgcaagccc
gatggtgtcctccccaatggtctcaacgtcaccaagttctcggccatgcacgagttccag
aacctccaccagcaaaacaaggagaagattcatgactttgtccgtggtcacttctacggc
cattacgattttgagccagaaaacacgctctacttctttactgcgggtcgctacgagttc
aggaataagggtgtggacatgtttatcgagtcgcttgcccgtctcaaccaccgcctcaag
accgccggaagcaagacgacagttgttgctttcattatcatgcctgcccagaccacttcc
ttgaccgttgaagcattgaagggacaggctgtcatcaagtctctgagagataccgtcgat
gttattgagcgtggaattggccgccgcatctttgagcgctctgtcaagtggcacgagggc
gacccgttgcctgaggagaaggagctgattaccagtcaggaccgtgttctccttcgtcgt
cgtctctttgccatgaagaggcacacgctcccacccattgttacccacaacatgctcaac
gaccacgaggacccaattttgaaccagatccgccgggtacagctcttcaaccatccctca
gaccgagtcaagattgttttccatcccgagttcttgagctcggccaaccccgtgttgcct
ctcgattacgatgactttgtgcgcggcacccatctgggcgtcttcgcttcttactacgag
ccttggggctacactccggcagaatgcactgtgatgggtgtaccaagcatcaccaccaac
ctctctggattcggctgctacatggaggaactcattgagaactcgagcgactacggtatc
tacatcgtggatcgtcgctccaagggagtcgatgactcggtcaaccagcttactcagtac
atgtttgaatttacccagaagagccgcagacagcgcatcaaccagagaaacagaaccgag
cgtttgagcgatctcttggactggaagcgaatgggtatggagtacgtcaaggcacgccaa
cttgcgttgcgccgcgcctatcctacatctttcaatggcgaggaggaggaagacttcatc
ccaggagtcgagcaaaagatatctcgtcccttctcagtaccgggctcgcctagagaccgg
actggtatgatgacccctggcgattttgctagtcttcaggagagtcacgagggtctgagt
accgaggactacgttgcatggaagttacctgaggaagaggaccccgaagagtatcctttc
ccgcttaccctgaagcagcgtacggggccgggtagccccctcgacagtattcagggtcta
caactcaacggcaccaggtaa

DBGET integrated database retrieval system