KEGG   Neurospora tetrasperma: NEUTE1DRAFT71896Help
Entry
NEUTE1DRAFT71896  CDS       T03451                                 

Gene name
NEUTE1DRAFT_71896
Definition
(RefSeq) succinate dehydrogenase flavoprotein subunit mitochondrial precursor
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
nte  Neurospora tetrasperma
Pathway
nte00020  Citrate cycle (TCA cycle)
nte00190  Oxidative phosphorylation
nte01100  Metabolic pathways
nte01110  Biosynthesis of secondary metabolites
nte01130  Biosynthesis of antibiotics
nte01200  Carbon metabolism
Module
nte_M00009  Citrate cycle (TCA cycle, Krebs cycle)
nte_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
nte_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:nte00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    NEUTE1DRAFT71896 (NEUTE1DRAFT_71896)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    NEUTE1DRAFT71896 (NEUTE1DRAFT_71896)
Enzymes [BR:nte01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     NEUTE1DRAFT71896 (NEUTE1DRAFT_71896)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 GIDA Thi4 FAD_binding_3 DAO HI0933_like
Motif
Other DBs
NCBI-GeneID: 20829547
NCBI-ProteinID: XP_009856021
JGI: Neute_matA2_71896
UniProt: F8N1V5
LinkDB All DBs
Position
Unknown
AA seq 648 aa AA seqDB search
MSSLAWRKLAAAPTLARAASRVQNRAFSSTRPAARVIAPGPLRAKEASPHLSSKYHVIDH
EYDAIVVGAGGAGLRAAFGLAEAGFNTACISKLFPTRSHTVAAQGGINAALGNMHEDDWR
WHMYDTVKGSDWLGDQDAIHYMTREAPASIVELENYGCPFSRTEDGKIYQRAFGGQSKEF
GKGGQAYRCCAAADRTGHALLHTLYGQSLRHNTNYFIEYFAVDLIMQDGECRGVLAYNQE
DGTLHRFLANNTVLATGGYGRAYFSCTSAHTCTGDGSAMVARAGLPNQDLEFVQFHPTGI
YGAGCLITEGARGEGGYLLNSEGERFMERYAPTAKDLASRDVVSRSMTMEIREGRGVGPE
KDHIYLQLSHLPAEILAERLPGISETAGIFAGVDVRKQPIPVLPTVHYNMGGIPTRYTGE
VLTVDEQGNDKVVPGLFACGEAASVSVHGANRLGANSLLDLVVFGRAVSHTIRDKFTPGS
KLKPIEADAGSESIEVLDKIRTSDGPKSTAEIRLAMQKTMQRDVSVFRTQESLDEGVEKI
TQVDQMFDQVGIKDRSMIWNSDLVETLELRNLLTCATQTAVSAANRKESRGAHAREDYPE
RDDKNWMKHTLSWQKQPHGKIELGYRRVIDTTLDEKECPPVPPFKRVY
NT seq 1947 nt NT seq  +upstreamnt  +downstreamnt
atgtcctctttggcttggagaaagttggctgcggcgcccacgctcgcgcgtgccgccagc
agagtccagaacagagccttttcctcgacaaggccggccgcccgcgtcatcgctcccggt
cctctccgtgctaaggaggcttctccccatctcagcagcaagtaccatgtcatcgaccac
gagtacgatgccatcgttgtcggtgccggcggtgccggtctccgtgccgctttcggtctc
gccgaggccggcttcaacaccgcctgcatttccaagctcttccccaccagatctcacacc
gtcgctgcccagggtggtatcaacgctgcgctcggcaacatgcacgaggatgactggagg
tggcacatgtacgacaccgtcaagggctccgactggctcggtgaccaggatgctattcac
tacatgacccgcgaggctcccgcctccattgtcgagctcgagaactacggctgccccttc
tcccgtaccgaggacggcaagatctaccagcgtgctttcggtggtcagtccaaggagttc
ggcaagggtggccaggcctaccgctgctgcgctgctgccgatcgtaccggccacgctctt
ctccacaccctctacggccagtctctccgccacaacaccaactacttcatcgagtacttc
gccgtcgacctgatcatgcaggatggcgagtgccgtggtgtcctcgcctacaaccaggag
gacggcaccctccaccgtttcctcgccaacaacaccgtcctcgccaccggtggatacgga
cgcgcctacttctcctgcacttccgcccacacctgcaccggtgacggttccgccatggtt
gcccgtgccggtctccctaaccaggatctcgagttcgtccagttccaccctaccggtatc
tacggcgccggctgcttgatcaccgagggtgctcgtggtgagggtggttacctcctcaac
tctgagggtgagcgtttcatggagcgttatgcccctaccgccaaggatctcgcctcccgt
gatgtcgtttcccgctccatgaccatggagatccgcgagggccgtggtgtcggccccgag
aaggaccacatctacctccagctcagccatctccccgccgagattctcgccgagcgtctc
cccggtatctctgagaccgccggtatcttcgctggtgtcgatgtccgcaagcagcccatc
cccgtcctccccaccgttcactacaacatgggtggtatccccactcgctacactggtgag
gttcttaccgtcgatgagcagggcaacgacaaggttgtccctggtctcttcgcttgcggt
gaggctgcttccgtctctgtccacggtgctaaccgccttggtgccaactctcttctcgac
ttggtcgtcttcggccgtgccgtctcccacaccatccgtgacaagttcactcctggctct
aagctgaagcccattgaggccgatgccggttccgagtccatcgaggtcctcgacaagatc
cgcacttccgacggccccaagagcaccgccgagatccgcctcgccatgcagaagaccatg
cagcgcgacgtctccgtcttccgtacccaggagtcccttgacgagggtgttgagaagatc
acccaggtcgaccagatgttcgaccaggtcggcatcaaggaccgctccatgatctggaac
tctgatctcgtcgagacccttgagctccgcaacttgctcacttgcgccacccagaccgcc
gtctccgccgccaaccgcaaggaatctcgtggtgcccacgcccgtgaggattaccccgag
cgtgacgacaagaactggatgaagcataccctctcttggcagaagcagccccacggcaag
atcgagctcggttaccgccgtgtcattgacactacccttgacgagaaggagtgccctcct
gttcctcctttcaagcgtgtctactaa

DBGET integrated database retrieval system