KEGG   Neurospora tetrasperma: NEUTE1DRAFT81451Help
Entry
NEUTE1DRAFT81451  CDS       T03451                                 

Gene name
NEUTE1DRAFT_81451
Definition
(RefSeq) DNA ligase 4
  KO
K10777  DNA ligase 4 [EC:6.5.1.1]
Organism
nte  Neurospora tetrasperma
Pathway
nte03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:nte00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    NEUTE1DRAFT81451 (NEUTE1DRAFT_81451)
Enzymes [BR:nte01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     NEUTE1DRAFT81451 (NEUTE1DRAFT_81451)
DNA repair and recombination proteins [BR:nte03400]
 Eukaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    DNA Ligase 4 complex
     NEUTE1DRAFT81451 (NEUTE1DRAFT_81451)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C RNA_ligase BRCT_2 BRCT DNA_ligase_IV TSC22 UPF0560
Motif
Other DBs
NCBI-GeneID: 20830407
NCBI-ProteinID: XP_009850774
JGI: Neute_matA2_81451
UniProt: F8MM01
LinkDB All DBs
Position
Unknown
AA seq 1046 aa AA seqDB search
MNTNRRSRSPDEEALEEDQHQYGAGTLSLEELDEQPRNHSKTFPFSDLFRTLFNPLIDCK
PSTSGGTVRGPKPGRGGHFSKVSYHEQRRHIIERFMSRWRSEVGNDFYPAMRLILSDKDR
DRGVYGLKENTIGKLLVKVMKIDRNSEDGYNLMHWKLPGSQSGVSRSVGDFAGRCFEVVS
KRAMRAQPGELTIADVNVLLDRLAAASGEAEQLPIFEEFYRQMNAEEMMWLVRIILKDMR
VGATERTFLNLWHPDAEALFSVSSSLRRVCWELFDPEFRLEQQETGIKLMQCFQPQLAQF
QMTTTWEKLVKNLGVTEENPEFWIEEKLDGERMQMHMIEDDTVPGGFRFAFWSRKAKDYT
YLYGESLEDEQSALTRHLHKAFDDGVRNLILDGEMITWDIDIDKMVPFGTLKTAALEQQK
NPSKAGPRPLYRVFDILLLNDKPLTEYTLNDRRRALERAVVGVHRRLEILPFERATSPDA
IEPLLRRVVAEASEGLVLKNPRSRYSLNSRNNDWIKVKPEYMSDFGESLDCVVVGGYFGS
GRRGGTLSSFLCGVRVSQNFIKSGNASAEKCLSFVKVGGGFKAEDYAEIRHHTEGKWQDW
DPSSPPTEYIELGGGEKLQYEKPDVWIRPSDSVVISVKAASITQSDQFAMGWTLRFPRFR
KLRLDRAWDSALDMDEFEVLRSKIKDQEQERKKMEMENRKRKPATKRARKDLVIAGMSDP
SSSSAATPVIAPRETREASERLFEGLDFCVLSDSLKPNKMAKPALEKLIKDHGGRIHQQV
VDHSGQGKIIIPIADKNVIKVASLRKANPEMDIVRPKWIFDCLVQPILFTKQKENKKGYL
LLFEPTHLFHSGSEETSEEAEQAVDRYGDSYAGDLADINELKAIMEGMESDDYVSDSDWD
SDPGRGRGRGDGFDMDHFLDHLEEQGTSLDELRSFMFRRCRVFFALPSAGNGDGAAESKA
SRLKNYIRFGNGKVVDELETATHVVVVTAPSGESSKKEGREMAAEIRYKISLREMGSPMP
RIVKGEWVEDSWKEATVVDEEEYVAG
NT seq 3141 nt NT seq  +upstreamnt  +downstreamnt
atgaataccaacaggcgatccagatcaccagatgaggaggcattggaagaggaccaacat
cagtacggggcaggtactctaagcctagaagaactcgatgagcaaccacgaaaccactcc
aaaaccttcccattctctgacctctttcggaccctcttcaaccctctcattgactgcaaa
ccctcaacctctgggggtacggtgcgcggccccaaaccaggacgaggcggccacttctcc
aaggtctcctaccatgaacagcgccggcacatcatcgagcgcttcatgtcgcgctggcgg
tccgaagttggcaacgatttttacccggccatgcgcctcatcctctccgacaaggaccgc
gaccgcggcgtgtatgggttgaaggagaacaccatcggcaagctgctggtcaaagtcatg
aagattgatcggaactcggaggatgggtataacctcatgcactggaagcttccggggagc
cagagtggggtaagccggtctgtaggggactttgcggggcgctgttttgaagtggtcagc
aagcgcgcgatgcgtgctcagccgggggaattgacgattgcggatgttaatgtcctgttg
gatcgcttggcggcggcaagcggggaggccgagcagttaccgatctttgaggagttttat
cggcagatgaatgcggaggagatgatgtggttggtgaggatcatattgaaggatatgagg
gtgggcgccacggaaaggacgtttctgaacctgtggcatccggatgccgaggcgctgttt
agcgtttcgtcgagcttgcggagggtgtgttgggagctgtttgatccagagtttcggctg
gaacagcaggagacggggattaagctgatgcagtgctttcagccgcagctggcgcagttt
cagatgacaacgacgtgggagaagttggtgaagaatttgggggtgacggaggagaacccg
gagttctggatcgaggagaagttggatggcgagaggatgcagatgcatatgatagaggat
gatactgtgcccggaggatttcggtttgccttttggtcgagaaaggcgaaggattatact
tatctctatggtgagagcttggaagatgagcagtccgctctgacacggcatctgcacaag
gcctttgacgacggcgtgcggaatttgattctcgacggagagatgattacctgggatatc
gatatcgacaagatggtgccctttggaacgctcaagacggccgcgttggaacaacagaag
aacccttctaaggctggtcctcgcccgctctaccgtgtctttgatattttgctgctcaac
gacaaaccactcaccgaatacaccctcaacgaccggcggagagctctcgagcgtgccgtc
gtcggtgtccaccgccgcttggaaattcttcccttcgagcgagccacctccccagacgct
attgagccactcttgcgacgagtcgtggccgaagcatcggagggtcttgtcctcaagaac
ccacgctctcgctattcactcaacagccgtaacaatgactggatcaaggttaaaccggag
tacatgtccgactttggcgaatcgctcgactgcgtcgtggtgggcgggtactttggctcc
ggccggcgcggcggcacgctctcctccttcctctgcggtgtgcgcgtatcccagaacttc
atcaaaagcggcaacgccagcgccgagaagtgcctctccttcgtcaaagtaggcggcggt
ttcaaagcggaggactacgccgaaatccggcaccacaccgaaggcaaatggcaggactgg
gacccttccagtccaccaacggaatacatcgagctcggcggcggggaaaagttacagtac
gagaagccggacgtgtggatccgacccagcgactcggtcgtcatctcggtcaaggccgcc
agcatcacacaatcggaccagttcgccatgggctggacgctgcgatttccacgcttccgc
aaactgcggctggatcgcgcgtgggattcggcgctggacatggacgagtttgaagtttta
agatccaaaatcaaggaccaggaacaggaacggaagaagatggagatggagaaccgcaag
cggaaaccggcgaccaagcgagcgaggaaggacctagttattgcggggatgtctgatcct
tcgtcttcttctgctgctacacccgtcatcgccccgagagagacaagagaagcgagcgaa
cggttgtttgaaggcttggacttttgcgtcctttcggattctctgaaaccaaacaaaatg
gctaaaccggctttggagaaactaatcaaagatcacggtggtcgtattcaccagcaggtt
gtggaccactccggtcaggggaagattatcatccccatagcagacaagaacgtgatcaaa
gtggctagtctgagaaaggccaacccggagatggacatcgtccggcctaaatggatcttt
gattgtcttgtgcagccgattcttttcacgaaacaaaaggaaaacaagaagggttatctc
ctcctcttcgaacccacccacctcttccactccggcagcgaagagacgtcagaagaagcg
gaacaagcagtggatagatacggcgatagctacgccggggacttggcagacataaatgag
ttgaaggcgatcatggagggtatggagtctgatgattatgtgtccgattccgactgggat
tcggatcctggcagaggaagaggaagaggcgacggatttgacatggatcatttcctagat
cacttggaagagcaggggacttcgttggatgagctacggtcgttcatgttccggaggtgt
cgggttttctttgctttacccagtgctggcaacggagacggggcagcagaaagtaaagcc
tcaagattgaagaactatatacgatttgggaacgggaaggtagttgacgagctggagacg
gcgacgcatgtcgttgtcgtgactgctccttctggggagagttcaaagaaggaagggaga
gaaatggcggcggaaataaggtataaaatcagcttaagagagatgggaagtccgatgccg
aggatcgtcaagggggaatgggtggaggactcgtggaaggaggcgacggtggttgatgag
gaagagtatgtggctgggtga

DBGET integrated database retrieval system