KEGG   Neurospora tetrasperma: NEUTE1DRAFT82595Help
Entry
NEUTE1DRAFT82595  CDS       T03451                                 

Gene name
NEUTE1DRAFT_82595
Definition
(RefSeq) repressible alkaline phosphatase precursor
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
nte  Neurospora tetrasperma
Pathway
nte00730  Thiamine metabolism
nte00790  Folate biosynthesis
nte01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nte00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    NEUTE1DRAFT82595 (NEUTE1DRAFT_82595)
   00790 Folate biosynthesis
    NEUTE1DRAFT82595 (NEUTE1DRAFT_82595)
Enzymes [BR:nte01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     NEUTE1DRAFT82595 (NEUTE1DRAFT_82595)
Exosome [BR:nte04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   NEUTE1DRAFT82595 (NEUTE1DRAFT_82595)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:nte00537]
 Enzymes
  NEUTE1DRAFT82595 (NEUTE1DRAFT_82595)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alk_phosphatase Metalloenzyme Sulfatase RskA DUF3357 DUF3328
Motif
Other DBs
NCBI-GeneID: 20830525
NCBI-ProteinID: XP_009851290
JGI: Neute_matA2_82595
UniProt: F8MKF4
LinkDB All DBs
Position
Unknown
AA seq 587 aa AA seqDB search
MAPSPERTPLLASDQSPDRENDNAAPRSRWRELALFTWALLATAAVIVLAVVIQHSNSTQ
HSSISPAAVSDSSSVAGDKKHGSPSGGKRNLVFMVSDGMGPASLSLTRSFRQLTQDLPID
DTLTLDRHFWGTSRTRSSNSLVTDSAAGATAFSCGLKSYNGAISMLPDHTPCGTVLEAAK
RAGYYTGLVVTTDITDATPACFAAHVFHRMQGDEIALHEVGHGPLGRVVDLMLGGGRCHF
LPRGTPGSCRQDDIDVTKLAQEEYGWNYVSDRAGFDSLGLGKNVSLPQLGLFATTDVPFE
IDRRNMADVYPSLSEMAATALAALEEATKDSDKGFFLMIEGSRIDHAGHINDPAAQVREV
LEYDKTFKSVLDFIEKSDTETILVATSDHETGGLSTAWQAPSELPVYNWHPTVLARANAS
SEFLTALLLKHIAETGDKEESLLRWINDELVVKHLNIKDASEVELNSIASNPALAIQLFA
RMVSVRARVGWSTHGHSAVDVNIYSSGGPGTEKIRGNVENTDVGKFLRGWLDLDSEVENI
TKELVKKLGDKAPSQKQLEKIEKASTAFEADGLAHGGFESGLYGHVL
NT seq 1764 nt NT seq  +upstreamnt  +downstreamnt
atggcgccgtctccggaacgcacgccgttgttggcctctgaccagtctcccgatcgcgag
aacgacaatgccgctcccaggtcacgatggcgcgagcttgcgctcttcacctgggccctt
ctggctaccgccgccgtcatcgttttggccgtggtgatccagcacagtaactccacccaa
cactcgtcgatctcgccggccgcagtctctgactcctcctctgtagccggcgacaagaag
cacggttctccgtccggcggcaagcgcaacttggtcttcatggtatccgatggcatggga
cccgcttcgctctctcttacgcgctccttccgccagctcacccaggacttgcctatcgac
gataccctcaccctcgaccgtcacttttggggtacctcccgcacgcgctcgagcaacagc
ttggtgacggactctgctgccggtgccactgccttctcctgcggcctgaagagctacaat
ggggctatctcgatgcttcccgatcacacaccatgcggtaccgtcctcgaagctgccaag
cgtgctggatactacaccggcttggtcgtgacgaccgatatcacggacgccactcctgct
tgcttcgccgctcacgtcttccatcgcatgcagggcgatgagattgcgctacatgaggtc
ggtcatggacccctcggtcgcgttgtcgatctcatgctgggcggcggcaggtgccacttc
ttgcccaggggaactccgggcagctgcagacaggatgacatcgatgttactaagctcgcc
caggaggagtatggatggaactacgttagtgatcgcgccggcttcgattcccttggcttg
ggcaagaacgtttccttgccccagttgggtctgtttgcgaccacagatgttcccttcgag
atcgaccgccgcaacatggcggatgtgtaccctagtctgagcgagatggctgccacggct
ctggcggcgcttgaggaggctaccaaggacagcgacaagggtttcttcctcatgattgag
ggtagcagaatcgaccatgccggtcacatcaacgatcctgctgctcaggttcgtgaggtg
cttgagtacgacaagactttcaagtctgtccttgacttcattgagaagtcggacactgag
accattttggttgccaccagcgatcacgaaactggtggtctgtccactgcttggcaggcg
cccagtgaacttcccgtctacaactggcaccccaccgtcctcgctcgcgccaacgcctca
tctgagttcctcaccgccctcctcctcaagcacattgccgaaaccggcgacaaggaagag
tcgctcctccgctggatcaatgacgagctcgttgtcaagcacctcaacatcaaggacgcc
tccgaggtcgagcttaactcgattgccagcaaccccgccctggccatccagctttttgcc
cgcatggtcagtgtccgcgcccgtgtgggctggagcacgcacggccacagcgccgtggac
gtaaacatctacagctctggcggccccggcaccgagaaaatcaggggtaacgttgagaac
acggatgtcggcaagttcctgaggggatggctcgatttggatagcgaggtggagaatatc
accaaagagctggtcaagaagctgggcgacaaggctccctcgcagaagcagttggagaag
attgagaaggcgtccaccgcttttgaggctgatggattagctcatggcgggttcgagtcg
gggctttatggccatgtgttgtaa

DBGET integrated database retrieval system