KEGG   Neurospora tetrasperma: NEUTE1DRAFT84197Help
Entry
NEUTE1DRAFT84197  CDS       T03451                                 

Gene name
NEUTE1DRAFT_84197
Definition
(RefSeq) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
nte  Neurospora tetrasperma
Pathway
nte00250  Alanine, aspartate and glutamate metabolism
nte00410  beta-Alanine metabolism
nte00430  Taurine and hypotaurine metabolism
nte00650  Butanoate metabolism
nte01100  Metabolic pathways
nte01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nte00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    NEUTE1DRAFT84197 (NEUTE1DRAFT_84197)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    NEUTE1DRAFT84197 (NEUTE1DRAFT_84197)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    NEUTE1DRAFT84197 (NEUTE1DRAFT_84197)
   00430 Taurine and hypotaurine metabolism
    NEUTE1DRAFT84197 (NEUTE1DRAFT_84197)
Enzymes [BR:nte01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     NEUTE1DRAFT84197 (NEUTE1DRAFT_84197)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-GeneID: 20830695
NCBI-ProteinID: XP_009852290
JGI: Neute_matA2_84197
UniProt: F8MQT7
LinkDB All DBs
Position
Unknown
AA seq 521 aa AA seqDB search
MVHLTIIPKEDEIRDGLDIPLTGALKAVHLQLANDEDRFTTSVYGSKFAAADLPRHEMPD
EEMPKEVAYRMIKDELSLDGNPLLNLASFVTTYMEEEAEKLMTESLPKNFIDYEEYPQTA
DIQNRCVSMIGRLFNAPVKDAEASSAVGTSSVGSSEAIMLGVLAMKKRWKNKRIAEGKPV
DKPNLIMSSAVQVCWEKATRYFEVEEKFVYCTPDRYVIDPKETVDLVDENTIGICCILGT
TYTGEYEDVKAVNDLLVERGLDTPIHVDAASGGFVAPFVVPDLEWDFRLKNVVSINVSGH
KYGLVYPGVGWVVWRSAEYLPQELVFNINYLGADQASFTLNFSKGASQVIGQYYQLIRLG
KHGYRAIMSNLTRTADYLAESLAALGFIIMSQKSGQGLPLVAFRLKEDPDRTYDEFALAH
QLRVRGWIVPAYTMAPKTEGLKMLRIVVREDFSRNRCDGLISDIRSCQGILEQMDKETVK
KQQEFIHKHHVVSGKASHNHPKYHKEKHSLQGKTGKTHSIC
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atggtgcatcttactatcatccccaaggaggacgagatcagagacgggctcgacattcca
cttacgggcgccctcaaggcggttcatcttcagctcgccaacgatgaagaccgtttcact
acgagcgtgtacggctcaaagttcgccgccgccgacctaccccgccatgaaatgcccgat
gaggagatgcccaaggaagttgcttaccgcatgatcaaggacgagctgagcctggatggc
aacccattgctcaacctcgcctcgtttgttaccacatacatggaggaagaagctgaaaag
ctcatgaccgagtccctccccaagaacttcatcgattacgaggagtatccccagacggcc
gatattcagaaccgctgcgtctccatgattggccgcctcttcaatgctccagtaaaggat
gcggaggctagcagcgccgtcggaacatcgagtgttggctcttctgaggccatcatgctc
ggtgtccttgccatgaaaaaacgttggaagaacaagcgcattgccgagggaaagcccgtt
gacaagcccaacctgatcatgtcatccgccgtccaggtctgctgggaaaaggccactcgt
tacttcgaagtggaagagaagttcgtctattgcacacccgaccgctacgtcatcgatccc
aaggagacggtcgatctggtggacgagaacaccattggtatctgctgcattcttggcaca
acatacactggcgaatacgaggatgtcaaggcagtcaatgacttgcttgtggagaggggg
ctggacacaccaatccatgtggacgccgccagcggaggtttcgttgccccctttgtcgta
cccgatttggaatgggattttaggctgaagaacgttgtatccatcaacgtctctggccac
aagtacggcctcgtctaccccggtgtcggttgggtcgtctggcgttctgccgagtacctt
ccccaggaactggttttcaacatcaactacctcggtgcagatcaagcctccttcaccctg
aacttctccaagggtgctagccaggtcatcggccagtactatcagctcatccgtctcggc
aagcacggctaccgcgctatcatgtccaacctgacgcgcacagctgactacctcgctgaa
tcgcttgccgctcttggcttcatcatcatgtcacaaaagtctggtcaaggcttgcctttg
gtcgcattccgtctcaaggaggatccggaccgtacctatgatgagttcgctcttgcccat
caacttcgtgtgcgcggatggatcgtccccgcgtacaccatggcgcccaaaacggaaggg
ctgaagatgctcagaatcgttgtcagagaagatttctctaggaacaggtgtgatgggctc
atcagtgatatcaggtcgtgccaaggtatacttgagcaaatggacaaggaaactgtcaag
aagcagcaggagtttatccacaaacatcatgttgtaagcgggaaggcatcgcacaaccat
cctaaatatcacaaggagaaacactcgttgcagggcaagacggggaagacgcactctatc
tgctga

DBGET integrated database retrieval system