KEGG   Neurospora tetrasperma: NEUTE1DRAFT84319Help
Entry
NEUTE1DRAFT84319  CDS       T03451                                 

Gene name
NEUTE1DRAFT_84319
Definition
(RefSeq) 2-oxoglutarate dehydrogenase E1 component mitochondrial precursor
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
nte  Neurospora tetrasperma
Pathway
nte00020  Citrate cycle (TCA cycle)
nte00310  Lysine degradation
nte00380  Tryptophan metabolism
nte01100  Metabolic pathways
nte01110  Biosynthesis of secondary metabolites
nte01130  Biosynthesis of antibiotics
nte01200  Carbon metabolism
Module
nte_M00009  Citrate cycle (TCA cycle, Krebs cycle)
nte_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:nte00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    NEUTE1DRAFT84319 (NEUTE1DRAFT_84319)
  09105 Amino acid metabolism
   00310 Lysine degradation
    NEUTE1DRAFT84319 (NEUTE1DRAFT_84319)
   00380 Tryptophan metabolism
    NEUTE1DRAFT84319 (NEUTE1DRAFT_84319)
Enzymes [BR:nte01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     NEUTE1DRAFT84319 (NEUTE1DRAFT_84319)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transket_pyr OxoGdeHyase_C E1_dh 2-oxogl_dehyd_N Imm52
Motif
Other DBs
NCBI-GeneID: 20830709
NCBI-ProteinID: XP_009852367
JGI: Neute_matA2_84319
UniProt: F8MR23
LinkDB All DBs
Position
Unknown
AA seq 1043 aa AA seqDB search
MLRGSIRALQTAGASKRCYSQVAQTTRATLKPAVGRRPLAVSQQRRHESALHSPPDPNDN
FLSGSAANYIDEMYLQWKQDPKSVHVSWQVYFKNMESGNMPISQAFQPPPSLVPGAANVV
PAIAAGAGVGIGEGANVTNHLKVQLLVRAYQARGHHKANIDPLGIRNTPASKGFGNIRPK
ELTPEYYGFTEKDLDTEYSLGPGILPRFARDGREKMTLREIIDACEKIYCGSYGVEFIHI
PDREKCDWLRERLEIPQPFKYSIDEKRRILDRLIWSSSFESFLATKYPNDKRFGLEGCET
LVPGMKALIDRSVDYGVKDIVIGMPHRGRLNVLSNVVRKPNEAIFSEFAGMAGADEEGSG
DVKYHLGMNFERPTPSGKRVQLSLVANPSHLEAEDPVVLGKVRAIQHYNNDESDHKSAMG
VLLHGDAAIAGQGIVYECLGFHNLPAFSTGGTIHLVVNNQIGFTTDPRFARSTAYCTDIA
KAIDAPVFHVNADDVEAVNFVCQLASDWRAEFKQDVIIDLVCYRKHGHNETDQPAFTQPL
MYKRISEKSPQIDIYVDQLLKEGTFTKEDIEEHKQWVWGMLEESFSKSKDYQPTSKEWTT
SAWNNFKSPKELASEVLPHMPTAVDKPTLEHIGTVIGSTPEGFHAHRNLKRILTNRTKSV
VEGKGIDWATAEALAFGTLVKEGHHVRITGQDVERGTFSQRHAVFHDQETEDTYIPLQHI
SEDQAPFVISNSSLSEYGILGFEYGYSLQDPNGFNMWEAQFGDFANTAQVIIDQFLASGE
SKWMQRTGLVMSLPHGYDGQGPEHSSARMERFLSLCNEDPRIYPSPEKLERQHQDCNMQI
AYMTSPANLFHILRRQLKRQFRKPLVIFFSKALLRHPVARSDIEEFTDDAHFRWILPDSA
HQTGEIKAPEEIERVILCTGQVYAALLKHRQDNKIDNVAFTRIEQLHPFPWEQLRENLDQ
YPNAKTIVWAQEEPLNAGAWSYTQPRLETLLNHTKHHDRKHVMYAGRAPSASVATGKKSS
HLKEEKELLEMAFSVTQSKLKGE
NT seq 3132 nt NT seq  +upstreamnt  +downstreamnt
atgttgcgcggttccatccgggccctgcagaccgcaggcgcctcaaaacgatgctattcc
caggtcgcccagaccaccagggccaccctcaagcccgccgttggccgccgtcccctggcc
gtctcccagcagaggcgccatgagagcgccctccacagccctcccgaccccaacgacaac
ttcctctcgggcagcgccgccaactatatcgacgagatgtacctccagtggaagcaggac
cccaagagcgtccacgtctcgtggcaggtctacttcaagaacatggagagcggcaacatg
cccatctcccaggccttccagcctcctcccagcctggttcccggtgccgccaacgtggtg
cccgcgatcgctgccggcgccggcgtcggcattggcgagggtgccaacgtcaccaaccac
ttgaaggtccagctcctcgtccgcgcctaccaggcccgtggtcaccacaaggccaacatt
gaccctctgggcatccgcaacacccctgcctccaagggcttcggcaacatcaggcccaag
gagctcacccccgaatactacggcttcaccgagaaggacctcgacaccgagtacagcctc
ggccccggcatcctcccccgtttcgcccgcgatggccgcgagaagatgacgctccgcgag
atcatcgatgcctgcgagaagatctactgcggctcctatggtgtcgagttcatccacatc
cccgacagggagaagtgcgactggctccgtgagcgtctcgagatcccccagcctttcaag
tactcgatcgatgagaagcgccgcatcctcgaccgcctcatctggtcctccagcttcgag
tccttcctcgccaccaagtaccccaacgacaagcgtttcggtcttgagggttgcgagacc
cttgttcctggtatgaaggccctcatcgaccgctccgttgactatggcgtcaaggacatc
gtcattggtatgccccatcgtggccgtctcaacgtcctctccaacgtcgtccgcaagccc
aacgaggccatcttttccgaattcgccggcatggccggtgccgatgaggagggttccggt
gatgtcaagtaccacttgggtatgaacttcgagcgccctaccccctcgggcaagcgcgtc
cagctctccctcgttgccaacccctcccatctcgaggctgaggaccccgtcgttctcggc
aaggtccgcgccatccagcactacaacaacgacgagagtgaccacaagagcgccatgggt
gtcctcctccacggtgacgccgccatcgctggtcagggtatcgtctacgagtgcttgggc
ttccacaacctccccgccttctctaccggtggtaccatccacttggtcgtcaacaaccag
atcggtttcaccaccgacccccgttttgcccgctccactgcctactgcacggatatcgca
aaggccattgacgcccctgtcttccacgtcaacgctgacgatgtcgaggctgtcaacttt
gtctgccagctcgcttctgactggcgtgccgagttcaagcaggacgttatcatcgacctt
gtctgctaccgcaagcacggtcacaacgagaccgaccagcctgcctttacccagcccctc
atgtacaagcgcatcagcgaaaagagccctcagatcgacatctacgttgaccagctcctc
aaggagggcaccttcaccaaggaggacatcgaggagcacaagcagtgggtctggggcatg
ctcgaggagagcttctccaagtccaaggactaccagcccacttccaaggagtggaccacc
agcgcctggaacaacttcaagagccccaaggagcttgctagcgaggttctcccccacatg
cctactgcggttgataagccgacccttgagcacattggtaccgtcattggcagcactccc
gagggcttccatgcccaccgcaacctgaagcgtatcctgaccaaccgcaccaagtccgtt
gtggagggcaagggcatcgactgggctaccgctgaggctcttgcctttggtaccctcgtc
aaggagggccaccacgtccgtatcaccggtcaggatgtcgagcgtggtaccttctctcag
cgccacgccgtcttccacgaccaggagactgaggacacctacattcctctccagcatatc
agcgaggaccaggcccccttcgtcatctccaactcttccctctccgagtatggtatcctc
ggttttgagtacggttactctctccaggaccccaacggcttcaacatgtgggaggcccag
ttcggtgatttcgccaacactgctcaggtcatcattgatcagttccttgcctctggtgag
agcaagtggatgcagcgtaccggtctcgtcatgtctctcccccacggttatgacggccag
ggtcccgagcactcttccgctcgtatggagcgtttcctctcgctttgcaacgaggatcct
cgcatctacccctcccccgagaagcttgagcgtcagcaccaggactgcaacatgcagatt
gcctacatgacctcccctgccaacctcttccacattctccgtcgccagctgaagagacaa
ttccgcaagcctctcgttatcttcttctccaaggcgctcttgcgtcaccccgttgctcgt
tccgacatcgaagagttcactgacgacgctcacttccgctggatccttcccgactctgct
caccagactggtgagatcaaggcccctgaggagattgagcgtgtcattctctgcactggt
caggtctatgccgctctcctcaagcaccgccaggacaacaagatcgacaacgtcgccttc
actcgtatcgagcagctccaccccttcccctgggagcagctccgtgagaacctcgaccag
taccccaacgccaagaccatcgtctgggcccaggaggagcccctcaacgctggtgcctgg
tcttacacccagcctcgccttgagactcttctcaaccacaccaagcaccatgaccgcaag
cacgtcatgtacgctggtcgtgctcccagcgcttctgtcgctactggcaagaagtcttct
cacctcaaggaggagaaggagcttctcgagatggctttctctgttacccagagcaagctc
aagggcgagtaa

DBGET integrated database retrieval system