KEGG   Neurospora tetrasperma: NEUTE1DRAFT85482Help
Entry
NEUTE1DRAFT85482  CDS       T03451                                 

Gene name
NEUTE1DRAFT_85482
Definition
(RefSeq) hypothetical protein
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
nte  Neurospora tetrasperma
Pathway
nte03030  DNA replication
nte03410  Base excision repair
nte03420  Nucleotide excision repair
nte03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:nte00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    NEUTE1DRAFT85482 (NEUTE1DRAFT_85482)
   03410 Base excision repair
    NEUTE1DRAFT85482 (NEUTE1DRAFT_85482)
   03420 Nucleotide excision repair
    NEUTE1DRAFT85482 (NEUTE1DRAFT_85482)
   03430 Mismatch repair
    NEUTE1DRAFT85482 (NEUTE1DRAFT_85482)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:nte03032]
    NEUTE1DRAFT85482 (NEUTE1DRAFT_85482)
   03400 DNA repair and recombination proteins [BR:nte03400]
    NEUTE1DRAFT85482 (NEUTE1DRAFT_85482)
Enzymes [BR:nte01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     NEUTE1DRAFT85482 (NEUTE1DRAFT_85482)
    6.5.1.6  DNA ligase (ATP or NAD+)
     NEUTE1DRAFT85482 (NEUTE1DRAFT_85482)
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     NEUTE1DRAFT85482 (NEUTE1DRAFT_85482)
DNA replication proteins [BR:nte03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    NEUTE1DRAFT85482 (NEUTE1DRAFT_85482)
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     NEUTE1DRAFT85482 (NEUTE1DRAFT_85482)
DNA repair and recombination proteins [BR:nte03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     NEUTE1DRAFT85482 (NEUTE1DRAFT_85482)
   NER (nucleotide excision repair)
    Other NER factors
     NEUTE1DRAFT85482 (NEUTE1DRAFT_85482)
   MMR (mismatch excision repair)
    Other MMR factors
     NEUTE1DRAFT85482 (NEUTE1DRAFT_85482)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C
Motif
Other DBs
NCBI-GeneID: 20830830
NCBI-ProteinID: XP_009853144
JGI: Neute_matA2_85482
UniProt: F8MTG7
LinkDB All DBs
Position
Unknown
AA seq 871 aa AA seqDB search
MSSPAKKRKLNSGTKQSFSVPSRGLEYFFAKQKQNGASKEPSPLPKESDSQPIQQGSSEE
HLNDEELARKLQAEWDAEARASSTPRENDVRSQDVAVSATEPVDTDGVEPTNESNPQTVT
APPKADRPKGKNTLSLSSAAATEDQASASIPLDESPLTFNPSKYIHQLQESWATDRGDAS
YALLIRCFVLVSSTTSRIKIVDTLVNCVRLLIEGDPSSLLPAVWLATNAISPPYVSMELG
LGGSAISKALKQVCGLDNRSLKALNDKLGDPGDVAFEAKKKQSFTLRKPKPLTIKGVFQS
LVKISKTQGQGSGDVKQRIVDKLLQDARGGEESRYVVRTLCQHVTVKTTMLIALARAFLL
SKPPGANIPTKDPNQLARLKKEELAEVYAKAEEIVKASYARHPDYNDLVPVLLEIGVSEE
LLVRCGLTLHIPLRPMLGGITRDLSEMLSRLQGRDFACEYKYDGQRAQIHCDERGVVSIF
SRHLELMTDKYPDLVALVPKIRGEDVQSFIMEGEVVAVDRATGELKNFQTLTNRARKDVA
IGTITIDVCLFAFDLMYLNGQPLLNRSFRERRDMLRSLFVEIPHHFTWVKSIDATSQESE
TVLEFFKSAVDSKCEGIMVKILDNLPELEALGPDDNTNSIIPKEQKQSRRKPLLATYEPD
KRLDSWLKVKKDYIGTSAGVDTLDLIPIAAWHGTGRKAKWWSPILLAVRNEETGSLEAVC
KCMSGFTDSFYKANREVYDKDGSFSSDGEPRNVHVAKPGFVEYAGGNPDVWFEPQEVWEV
AFADITISPTYTAAIGLVREDKGLSLRFPRFLRKREDKGIEEASTSDFLAGLWRKQEVKT
PAPPPVEGGREIDEAGLENEDEDHDEDEDGE
NT seq 2616 nt NT seq  +upstreamnt  +downstreamnt
atgtccagtccagccaagaaacgcaaactcaactcgggcacaaaacaatctttttctgtt
cctagcagaggtcttgagtactttttcgctaaacaaaagcagaatggggcttccaaggaa
ccatctcctttgcccaaggaatccgactcacagcctattcagcaagggtcgtcagaagag
catttgaatgatgaggagcttgcgcgaaagctgcaggccgaatgggatgctgaagcaagg
gcctcatcaacaccgagggaaaatgatgttcgctcgcaggatgtcgcagtgtcggcaaca
gagcccgtggacacagatggcgttgaaccaaccaatgagtcaaatccacagacagtaacc
gcaccacccaaggctgaccggcccaaagggaagaatacattgtcactctcttccgcagcc
gctacagaagaccaggcatcggcatctattcctcttgacgaaagtcccttgaccttcaat
ccatccaagtacatccaccagctccaggaatcgtgggccactgatagaggtgatgcgtcc
tacgccctccttatacgatgctttgtcttggttagcagcaccacaagcaggatcaaaatt
gtcgacacgctagtcaactgtgtccgattgttgattgagggagatccgtccagcttgttg
cccgcagtatggctggcaacgaacgcaatttccccaccgtacgtgtctatggaacttggt
ttgggtggttctgctatctcaaaggctctcaaacaagtgtgtggcctcgacaacaggtcg
ctcaaagcacttaacgataagctgggtgacccgggcgatgttgcatttgaggcaaagaag
aaacaaagcttcactctacgaaagccaaaaccgttaacaatcaagggggtcttccagtca
ctagtcaaaatctccaagactcaggggcagggcagcggtgatgtaaagcaacggattgtt
gacaaactgctccaagatgctcgcggaggcgaagaaagcagatatgtcgtcaggacatta
tgtcaacatgtgactgtcaaaaccactatgctcatcgccctagctcgagcttttttgctt
tccaaacctccaggcgcgaacatcccgacgaaagacccaaatcaactggcaaggctgaag
aaagaggagctagccgaggtatatgcgaaggccgaggaaattgtcaaggcctcgtatgcc
cgacatccagattacaacgaccttgtcccggtactgctcgagattggcgtgtctgaggag
ttattggtgcgatgtggtctaacacttcacattccgctgcggcccatgcttgggggcatc
accagggacttgtcagaaatgctctctcgacttcaagggcgtgatttcgcttgcgagtac
aagtatgacggccaacgtgcccaaatccattgtgacgagaggggagttgtctccatcttt
tcccgccatctagaactcatgacagacaaataccccgatctcgtcgcgctcgttcccaaa
attaggggtgaagatgtccagagcttcatcatggagggcgaagtggtcgccgtggaccgg
gccacaggcgagctgaagaatttccagacgttaacgaaccgtgccagaaaagacgttgcg
atagggaccatcactatcgacgtgtgtctgttcgcattcgacctcatgtatctcaatgga
caaccactcctcaacagatctttccgagaacgacgagacatgttgcgatcactctttgtg
gagataccgcaccattttacatgggtcaaaagcatcgatgcgacatcccaagagtcggaa
acagtcctcgagttcttcaagtcggccgttgatagcaagtgtgaaggtatcatggtcaag
attctcgacaatttaccagagcttgaagcccttgggcctgacgacaataccaactcaata
attcccaaagagcagaagcaatcgcgccgcaaacccctcctagcaacttacgaacccgac
aagcgtctcgactcctggcttaaagtcaaaaaggactacatcggcacctcggccggcgtc
gacacgctggacctaatacccatcgccgcctggcacggcaccggccgcaaagccaagtgg
tggtcaccaatcctgctagccgtgcgcaacgaagaaaccggctcactagaagcagtttgc
aagtgcatgtcgggcttcaccgattccttctacaaagccaaccgcgaagtctacgacaag
gacggctccttcagttccgatggggagcccaggaatgtacatgtggcgaagccgggattt
gtcgagtacgcgggaggcaacccggatgtgtggtttgagccgcaggaggtgtgggaagtg
gcgtttgcggatatcacgattagtccgacgtacacggcggcgattgggttggtgcgggag
gataaggggctgagtttgaggtttccgaggttcttgcgcaagagggaggataagggaatt
gaggaggcgagtacgagcgattttttggcggggttgtggaggaagcaggaggtgaagaca
cccgcaccgccgccggtcgagggtggaagggaaattgatgaagcgggtttggagaatgag
gatgaggatcacgatgaggatgaggatggagaatag

DBGET integrated database retrieval system