KEGG   Neurospora tetrasperma: NEUTE1DRAFT86742Help
Entry
NEUTE1DRAFT86742  CDS       T03451                                 

Gene name
NEUTE1DRAFT_86742
Definition
(RefSeq) hypothetical protein
Organism
nte  Neurospora tetrasperma
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase p450
Motif
Other DBs
NCBI-GeneID: 20830959
NCBI-ProteinID: XP_009853734
JGI: Neute_matA2_86742
UniProt: F8MSZ4
LinkDB All DBs
Position
Unknown
AA seq 1134 aa AA seqDB search
MSSYQNGTNGHSASTSDNGKESKSRNVIGPDPKAERTASMAKPRPTSMKLPFTGASRQGV
ENAFERHRQTIQSAVQPLPTQQGAGTFSENKKWGKLSSDLMTLRWADIKTLKHMVVAKIK
GERLTDDKTMIMEKVIQLVSNLPSNSKLRVELTNGFLGELWYTLEHPPSIYVGEYYQYRK
ADGSCNNIMFPQLGAAGTTYARSVRPNVIRQGALPDPELIFDSVMKRTEYKSHPNNVSSI
LWYWASIIIHDLFWTDYRDMSKSKTSSYLDLSPLYGSNQDMQDTIRTFKDGKLKVDCYAD
KRLLGMPPGVSVLLIFFNRFHNYTCDNLIAINEDGRFNKPSPKLEGEKAEAAWKKYDNDL
FQTARLITSGLYINITLLDYVRNIVNLNRVDTTWTLDPRADTGIDVGTKDGAERGTGNVV
SAEFNLCYRWHSCISAKDEAWIEDFYYELFGKPGSDLSFHELIMGFGKFEGGIPADPADR
PIRKDKGHFTRDANGKISDDELAECIADAIEDPAGSFGAKNVPPSMRAVEILGIIQGRKW
NLAGLNEFRKHFGLKPYETFEDINSDPGVSEALRRLYDHPDFVELYPGIVAEEHKSPMVP
GVGIAPTYTISRVVLSDAVCLVRGDRHYTIDYNPRNLTNWGYNEVQYDLNLNHGCVFYKL
FMRALPNHFKENSVYAHYPMVTPAENKKILTDLKRDHLFDWSRPTRQPKPHQVKTHAGAQ
HVLDNDKEGTSGAYKSSWHAGLESLLGKPLSNNSPEAHDSQRRDIHEQLYSAEWAEQAKA
FFAQTTDALLAGESYNVGGHLLVDLVRDVGNIVPTLFAAKVFGISLQTKNNANGLYTPQE
LYAVLAVIFAAIFYDHDPVKTHQLRDAARTVATQLGTALESAVKGQTSFFGSLLGGGGSG
SSNNALTAYGTDLVKRLSKAGLSASDVAFGQVLPIVASSVPSIAEAFASAVDFYLGEKGQ
AHLGAIQELARQPASASADAQLLGYVLEGIRLSGNALGAFRQASAVDAIKEEDGSEVRVQ
PGDRVFVSVKSAAQSPTTFPNPEEVNPSRPLEAYKIFFFGTHSYLGHEVSQIALSEMFRS
LFKRSNVRRAPGPQGQLKKITRELNEELSQTFYLREDWGAVTPFPVTMKVTWDE
NT seq 3405 nt NT seq  +upstreamnt  +downstreamnt
atgtccagctatcagaatggcacaaacggccactcggccagcaccagcgacaatggcaag
gagtccaagagccgaaacgtcatcggccccgaccccaaggccgagaggacggctagcatg
gccaagcccagacctacctcgatgaagctcccctttaccggcgccagccgacaaggagta
gagaacgcgtttgagagacacagacagaccatccagtcggctgtccagccgctgcctacc
cagcaaggcgcaggcactttcagcgagaacaagaaatggggcaagctcagcagtgacttg
atgacccttcgatgggcagacatcaagaccctgaagcacatggtagtggccaagatcaag
ggcgagaggctcacagatgacaagaccatgatcatggaaaaggtcatccagcttgtctct
aacctccccagcaactccaagctacgagtcgagttgaccaacggcttcttgggtgagctg
tggtacacactcgagcaccccccttcgatatacgtgggcgagtattatcagtacaggaag
gccgatggttcttgcaacaacatcatgttcccccagctcggtgctgccggcaccacatat
gcgcggtctgtgaggcccaacgtcatcaggcagggcgctcttcccgacccggaactcatc
ttcgactcggtcatgaagcgcaccgagtacaagtcgcaccccaacaacgtgtccagtatt
ttgtggtactgggccagcatcatcatccacgatctgttctggactgactaccgcgacatg
agcaagtccaagacgtcttcctacctcgacctgtccccgctgtacggcagcaaccaggac
atgcaggacaccatccgtaccttcaaggacggtaagctcaaggtggactgctacgccgac
aagcgcctgctgggcatgcctcccggcgtcagcgtgctgctcatcttcttcaaccgcttc
cacaactacacgtgcgacaacctgattgccatcaacgaggacggccggttcaacaagccg
tcgcccaagctcgagggcgagaaggccgaggcggcgtggaagaagtacgacaacgacctg
ttccagacggcccggctcatcacttcgggtctgtacatcaacatcaccctgctcgactac
gtgcgcaacattgtcaacctcaaccgcgtcgacaccacctggacgctcgatccccgtgcc
gacacgggcattgacgtgggcaccaaggacggtgcggagcgcggtaccggcaacgtggtc
tcggccgagttcaacctctgctaccggtggcactcgtgcatctcggccaaggacgaggcc
tggatcgaggatttctactacgagctctttggcaagcccggcagcgacctcagcttccac
gagctgatcatgggcttcggcaagttcgagggtggaattcctgcggacccggccgaccgg
ccgattcgcaaggacaagggccacttcacccgcgacgccaacggcaagatcagcgacgac
gagctggccgagtgcattgccgacgccatcgaggatcccgccggttcctttggcgccaag
aacgtgcctccttccatgcgggccgttgagatcctcggtatcatccagggccgcaaatgg
aacctggccggcctgaacgagttccgcaagcactttggcctcaagccgtacgagaccttt
gaggacatcaactcggaccccggcgtgtccgaggctctccggcgtctgtacgaccacccg
gattttgtcgagctgtacccgggaattgtcgccgaagagcacaagtcgcccatggttccc
ggcgtgggcattgcgccgacctacaccatctcgcgcgtggtgctgtccgatgccgtctgc
cttgtccgcggcgaccgccactacaccatcgactacaacccgcgcaacctgaccaactgg
ggctacaacgaggtgcagtacgacctgaacctcaaccacggttgcgtcttctacaagctc
ttcatgcgcgccctgcccaaccacttcaaggagaactcggtgtatgcgcactaccccatg
gtgacgcccgcggagaacaagaagatcctcacggacctcaagcgcgaccacctctttgac
tggagccgacccacccgccagcccaagccgcaccaggtgaagacgcacgcgggcgcccag
cacgtgctcgacaacgacaaggagggcacgagtggcgcgtacaagtcctcatggcacgcc
ggtctcgagtccctcctcggcaaacccctcagcaacaacagccccgaggcccacgacagc
caacgccgcgacatccacgagcagctgtacagcgccgagtgggcagagcaagccaaggcc
tttttcgcgcaaacgaccgacgccctcctggccggggagagctacaacgtcggcggccac
ctgctcgtcgacctcgtccgcgacgtcggcaacattgtgcctaccttgttcgccgccaag
gtgtttggcatttcgctgcagacgaagaacaacgccaatgggctgtacaccccgcaggag
ctgtatgccgtgctagctgttatcttcgccgccatcttctacgaccacgaccccgtcaag
acgcaccagctgcgcgacgcggcccgcacggtggcgacgcagctcggtactgctttggag
agcgccgtcaagggccagacttccttctttgggtcgcttctgggtggtggtggtagcggt
agcagcaacaacgcgctgactgcctatggtaccgacctcgtcaagcggttgtccaaggcc
gggctgagcgcgtcggatgtcgcgttcggtcaggtcttgcctatcgtggcgtcgagcgtg
ccgagtattgccgaggcgttcgcgagcgctgtggacttttatctcggcgagaagggacag
gcgcacttgggagccatccaggagctggcgaggcagccggcgagtgcgagcgcggatgcg
cagttgcttgggtatgtgttggagggcattcggttgtcgggcaacgctttgggggcgttc
aggcaggcgagtgcggtggatgccatcaaggaggaggatggcagcgaggtgagggtgcag
cctggtgatagggtgtttgttagcgtgaaatctgccgctcaatcaccaacgactttcccc
aaccccgaggaagtcaacccgtcccgcccgctggaggcctacaagatcttcttctttggt
acgcactcgtacctcggccacgaggtcagccagattgcgcttagtgagatgttccgcagc
ttgttcaagcggagcaacgtccgtcgggcgcccggaccgcagggccagctgaagaagatc
acgagggagttgaatgaggagctgagccagactttctacctccgcgaggactggggcgcc
gtgacgccgttccccgtgaccatgaaggttacttgggatgagtag

DBGET integrated database retrieval system