KEGG   Neurospora tetrasperma: NEUTE1DRAFT92039Help
Entry
NEUTE1DRAFT92039  CDS       T03451                                 

Gene name
NEUTE1DRAFT_92039
Definition
(RefSeq) hypothetical protein
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
nte  Neurospora tetrasperma
Pathway
nte00052  Galactose metabolism
nte00500  Starch and sucrose metabolism
nte01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nte00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    NEUTE1DRAFT92039 (NEUTE1DRAFT_92039)
   00500 Starch and sucrose metabolism
    NEUTE1DRAFT92039 (NEUTE1DRAFT_92039)
Enzymes [BR:nte01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     NEUTE1DRAFT92039 (NEUTE1DRAFT_92039)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N DUF5110 Rotavirus_VP7
Motif
Other DBs
NCBI-GeneID: 20831472
NCBI-ProteinID: XP_009856703
JGI: Neute_matA2_92039
UniProt: F8N146
LinkDB All DBs
Position
Unknown
AA seq 1044 aa AA seqDB search
MAVFTSASFFLLAAFVPRWTSAQHVSVVATSSRAGALSGTVAGDSPMFTFPASADIGPNV
LPNIFDPQAVNVQSVCPGYTATNAQKTEKGLTADLTLAGPPCNVYGNDIEHLKLTVEFQA
DNRINVQIQPRYTGPGNETWFILPEVLVPRPEAEPDANAAGSKLEISWSNEPTFSFTVKR
KETGDVLFTTEGRVLVYEDQFIEFGSSLPENYNLYGLGEVMHGFRLGNNLTRTLFAADVG
DNLDANIYGNHPIYLDTRYFTKDESGKLSYVTDPADKNAKYVSYTNGVFLRNAHAQEVLL
RPEGITWRTLGGSIDLYFFEGPSAQDIIKSYQLSTVGLPAMQQYWTLGFHQCRWGYSNWT
VVKDVVDNFRKFGIPLETIWTDIDYMKGYRDFENDPDQFSYEEGAKFLEELHKNHQHYVP
IVDSAIYVPNPDKPEDDYEPYHRGLEADAFIMNPDGSLYIGAVWPGYTVFPDWIGAALNG
TGTVSWWTDEFVRYYKKVAFDGIWIDMSEVASFCIGSCGTGNLTLNPVHPPWGLPGEPGA
LVLDYPEGFEKTNASEASSATSVYKTQYPDPTTTASTTSTTSYLRTTPTPGVRNINYPPY
VINNFHGDLGTHALSPNGTHHGGTVDYDFHNLFGHQILHATYQALLKVFEGKRPFIIGRS
TFAGSGKWAGHWGGDNYSLWAFLYFSIPQALSFSIFGFPMFGVDTCGFNGNTDHELCSRW
MQLSAFFPFYRNHNVRGAISQEPYVWSSVIDASKKAMRIRYLLLPYMYTLMAQASLSGNT
VMRALSWEFPQEPWLADADRQFMLGSAVMVTPCLVQGANTVDGVFPGVGDGTIWYDWYTY
KAASEGVQPGENVTIDAPLGHIPVFLRGGHVIPVQEPGMTTTESRQNEWSVIVALDGAGK
ANGTLYLDDGESLEPGENVKWVDFTVEKNSFRVTPQGKYLDRNSLANVTILGVAEAPLRV
TINSHLLGSASWSYNPEGKFLLVTELQDNFKEGAWASNWTLSWNSPSNSDSSPVQGGGGR
LEFSTANLLYAAAFGILFGRMFVL
NT seq 3135 nt NT seq  +upstreamnt  +downstreamnt
atggccgtcttcacatcggcttccttcttccttcttgcggcttttgtccctcgatggaca
tccgctcaacatgtatctgtggttgcaacgtcatctagagctggtgcattgagcgggacg
gtggcaggggattcccctatgttcactttcccagcttcagctgacatcggaccaaatgtc
ttacctaacatcttcgacccacaagcagttaatgttcaaagcgtctgtccaggatataca
gctactaatgcacaaaagacggagaagggactcacggctgacttgacccttgctggccct
ccctgcaatgtctatggcaacgacatcgagcacctgaagcttaccgttgagtttcaggcg
gacaatcggatcaatgtccagattcaacctcgctatactggccccggtaatgaaacttgg
ttcatacttcctgaggtgctcgtgccccgaccagaggccgagcctgatgcaaatgcggct
ggaagcaagctggaaatctcgtggtcgaacgagcccaccttctccttcacagtgaagcgt
aaggagactggagatgtcttgttcacgaccgagggccgtgttcttgtttatgaggatcag
ttcatcgagttcggctcctctttacccgagaattacaacctgtatggtctcggcgaagtt
atgcatggctttagactggggaacaatctgacacgcacgctgttcgctgcggatgtgggc
gacaacctcgatgccaacatctacggcaaccacccgatctatctcgacaccagatacttc
accaaggacgagtctggaaagttaagctacgttaccgacccggcagacaagaatgccaaa
tatgtttcgtatacaaacggtgtcttccttcgaaatgctcatgcacaggaagtgctcctc
cgacccgaaggtatcacctggaggactctcggcggaagcatcgatttgtacttctttgag
ggaccttcggctcaggatatcatcaagtcttatcagctcagtactgttggtcttcctgca
atgcagcagtattggactcttggctttcaccaatgtcgttggggatactcgaactggact
gttgtgaaggatgtcgttgacaatttccgcaagtttggcatcccgctggagacaatctgg
accgacattgattacatgaagggctatcgtgactttgaaaacgaccctgatcagttcagc
tacgaggaaggcgccaagttcctcgaggagcttcacaagaatcaccagcactacgtgcca
attgtcgactcggccatctatgttccaaatcctgacaagccagaggatgattacgaacct
taccaccgtggactcgaagctgatgctttcatcatgaacccagacggttcgctctatatc
ggtgcagtgtggcctggctacaccgtgttcccggactggattggtgcggccctcaacggt
acaggtaccgtcagctggtggacggacgagtttgttaggtactataagaaggtcgctttt
gatggcatctggattgacatgagcgaggttgcttctttctgcatcggaagctgtggcacg
ggcaacctgacgctcaatccggttcatccaccatggggtcttcccggtgagccaggtgct
cttgtgctcgattaccccgaaggttttgaaaaaaccaacgcgagtgaggcatcctctgca
acgtcggtttacaaaacgcagtacccagaccccacgactacagccagcaccactagcact
acttcttacctcaggacgacaccgactcctggagtgcgcaatatcaactatccaccatat
gtcatcaacaacttccacggcgaccttggcactcacgccctgagccccaatggtacccac
catggcggcacagttgactatgacttccacaacttgttcggccatcaaatcctccacgca
acttaccaggcacttctcaaagtctttgagggcaagcgtccttttatcatcggccgcagc
acctttgcgggttctggcaaatgggccggtcactggggcggtgataactattccctatgg
gcgtttctgtacttcagcattccccaggccctgtccttctccatcttcggtttccccatg
ttcggcgtagatacctgcggcttcaatggcaacaccgaccacgagctgtgctcacgatgg
atgcagctcagcgccttcttcccattttaccgcaaccacaacgtccgtggcgccatcagc
caggagccctacgtgtggagctctgtgatcgatgcgtccaagaaggcgatgaggattcga
tacctcctgctcccgtacatgtacacgcttatggcccaggccagcctgtctggaaatacg
gtcatgcgcgcactctcgtgggagttcccgcaagagccgtggttggcggatgcggatcgc
cagttcatgttgggcagcgcggtgatggtgacaccatgtcttgttcaaggggccaataca
gtggacggcgtgtttcctggagttggcgatgggaccatctggtatgattggtatacatac
aaggccgccagtgagggtgttcagcctggggagaatgtaacgatcgatgcacctctggga
cacattccggtttttctacggggtggccatgtcatcccagtgcaagagccgggcatgact
acgacggagagcagacaaaatgagtggagtgtcatcgttgctcttgatggtgcgggtaag
gcgaatggtacgttgtatctggatgatggtgagagtttggagccgggtgagaatgtgaag
tgggttgatttcacggttgagaagaactcatttcgagtgacacctcagggcaagtacctt
gaccgaaactcactggccaacgtcacgattctgggagtggccgaggcacctctgagagtg
actattaatagtcatttgctcggatcagcttcttggtcctacaaccccgaagggaagttc
cttttggtaaccgagctgcaggacaacttcaaggaaggggcatgggcatccaactggacg
ctgtcgtggaactcaccctcaaactcggactcgtctcctgttcagggaggcggcggcagg
ctcgagttcagcacggccaatttgctctatgcagctgctttcggcatcctttttggccgc
atgtttgtactttag

DBGET integrated database retrieval system