KEGG   Natranaerobius thermophilus: Nther_0139Help
Entry
Nther_0139        CDS       T00761                                 

Definition
(GenBank) DNA polymerase LigD, polymerase domain protein
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
nth  Natranaerobius thermophilus
Pathway
nth03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:nth00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    Nther_0139
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:nth03400]
    Nther_0139
Enzymes [BR:nth01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     Nther_0139
DNA repair and recombination proteins [BR:nth03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     Nther_0139
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ACB83738
UniProt: B2A484
LinkDB All DBs
Position
162817..163737
Genome map
AA seq 306 aa AA seqDB search
MRYMVNSQTLDVHGREVVLTNLLKPIWPEKDITKYDLIKYFLDMSPYILPHLKNRPLVIT
RFPEGVHKEGFYQKDIKKAGNSPSWLKTITIPTKNKERERQVIDYLVVDHPATLVWLGNL
AAVELHPWLSSVESLDYPDFGVFDLDPMPQADFYQVKTLAFSIKKILNQLEITGYPKLTG
SSGLQIFVPFYPKYTYQEIREFIHKVCLQVLDHHADIATIERKVNQRPSHKVYLDYLQNA
KGKTISAIYGPRANKGAHVSVPVNWEELANIETSRQYDVLSVGARMKNTGDVFKTILENK
QKLNFC
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
ttgagatatatggtcaatagtcaaaccttagatgtccacggacgcgaagttgtgttaact
aatttattaaaacctatctggccagaaaaagatattacaaaatatgacttaatcaaatac
tttcttgatatgtcaccttatatattgccccatttaaaaaatcgtcctttggttataact
aggttccctgaaggtgtgcataaggaaggattttatcagaaagatattaagaaagcaggt
aattcaccttcctggttaaaaacaattacaattccgactaaaaataaagaaagagaaaga
caagttatagactatttagttgtagatcatccagcaactttggtatggctggggaattta
gcggctgtagaacttcatccatggttatcaagtgtagagtctttagattatccggatttt
ggtgtttttgacttagatcccatgccccaagctgacttttatcaagttaaaactctagct
ttcagtatcaaaaaaattttaaatcagcttgagataacaggttatcccaagctgacaggc
tctagtggcttacaaatatttgtacctttttatcccaaatatacttatcaagaaatccga
gaattcattcataaagtatgtttgcaggttttggatcaccatgctgatattgcaacgatt
gagcgcaaagtaaatcagcgtccctctcataaggtttatctggattatttgcaaaatgca
aaaggtaaaacaatttctgctatttatggccctagagccaacaagggcgctcatgtgtcg
gttccggttaactgggaggaactggcgaatattgaaacatcccgacagtatgatgtgcta
tctgtaggagctcggatgaaaaataccggcgatgtatttaaaaccatcttagagaataaa
caaaaattaaacttttgctaa

DBGET integrated database retrieval system