KEGG   Natranaerobius thermophilus: Nther_1075Help
Entry
Nther_1075        CDS       T00761                                 

Definition
(GenBank) Superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
nth  Natranaerobius thermophilus
Brite
Enzymes [BR:nth01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Nther_1075
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: ACB84659
UniProt: B2A136
LinkDB All DBs
Position
1131731..1132318
Genome map
AA seq 195 aa AA seqDB search
MNFKLPDLPYSYNSLEPHYDQQTLKLHHSKHHQSYVNGLNNALEKLKVARENNDYNGIKH
WQRELAFHGSGHILHTLFFNNLGPEQGNLSKSLRDQINKDFGSFEMFAAQFTNAAKTVEA
SGWAVLAWNDVLEQLLVLTLEKHQNLTVIGAKPLLVIDMWEHAYYLQYQNDRAAYINAWW
EIVNWNEVSRRFENP
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atgaattttaaattaccggatctgccttatagttataattcactggaacctcattatgat
caacagaccttgaaacttcatcatagtaaacaccatcaatcctatgttaatggtttaaat
aatgctctagaaaaattaaaagttgctagagaaaacaatgattataacggtataaagcac
tggcaaagagaactagcctttcatggatctggccatattttacacactttattctttaat
aatttgggtccggaacaaggaaatctatcaaagagtctgcgggatcagattaacaaagat
tttggcagttttgaaatgtttgcagctcaatttaccaatgctgctaaaaccgttgaagct
tcgggttgggctgtcttagcatggaacgatgttttagagcaattgctggtactgacatta
gaaaaacatcaaaatctaactgtgattggtgctaaacctctattggtgattgacatgtgg
gaacacgcttattatcttcagtatcagaatgatcgagctgcttatattaatgcttggtgg
gagattgtcaattggaatgaggtttctagacgatttgaaaatccttaa

DBGET integrated database retrieval system