KEGG   Natranaerobius thermophilus: Nther_2237Help
Entry
Nther_2237        CDS       T00761                                 

Definition
(GenBank) hypothetical protein
Organism
nth  Natranaerobius thermophilus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FlgN DUF2408 Golgin_A5 Tweety RIH_assoc
Motif
Other DBs
NCBI-ProteinID: ACB85803
UniProt: B2A835
LinkDB All DBs
Position
complement(2375065..2375580)
Genome map
AA seq 171 aa AA seqDB search
MDKLLQDLCENLEEQLATYKLLVQQEEEKQEALIQGELSQLEELIKKEQKIVFQNGELER
KRQEIIAQLAEELGEVQDDLTISKLIEYAEGELEKRLSQVYRELEEIVITLKDLNIKNNS
LIQQSLSYINYSLDIVAGAGQDDPGTYGNDVGDDSGKAAKKSNRSFLDKKI
NT seq 516 nt NT seq  +upstreamnt  +downstreamnt
atggacaaactattacaagatctctgtgaaaatttagaagaacagttggccacttataaa
cttttggtacaacaggaagaagagaagcaggaggccttgattcagggcgagctaagtcag
ttagaagaactgattaaaaaggaacagaaaatagtctttcaaaacggtgaactcgagaga
aagcgccaggaaatcattgcccagttggctgaagaactgggtgaagttcaagatgatctg
actatttctaaattgatagaatacgcggaaggcgagctggaaaaacgcctatcccaggtt
tacagggaactggaagagatcgtgattactttgaaagatttgaacataaagaacaattcc
ctgatccaacagtccctctcatatataaattacagtttagatattgtggcaggtgccggt
caggatgatcccggcacttacggtaacgatgttggtgatgattcgggaaaagcggccaag
aaaagcaaccgcagctttttagataaaaagatttag

DBGET integrated database retrieval system