KEGG   Nicotiana tomentosiformis: 104084581Help
Entry
104084581         CDS       T05025                                 

Definition
(RefSeq) alpha-amylase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
nto  Nicotiana tomentosiformis
Pathway
nto00500  Starch and sucrose metabolism
nto01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nto00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    104084581
Enzymes [BR:nto01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     104084581
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amyl_C2 Alpha-amylase Glyco_hydro_70
Motif
Other DBs
NCBI-GeneID: 104084581
NCBI-ProteinID: XP_009586775
LinkDB All DBs
Position
Unknown
AA seq 422 aa AA seqDB search
MNSLFPLCLILSLFPIFATPTLLFQGFNWESSNQQGGWYNSLINLVPDLAKAGVTHVWLP
PSSNSVSPQGYMPGRLYDLDTSKYGNQQQLQALIKALHDQGIKVVADIVINHRCADKKDS
RGIYCIFEGGTSDDRLDWGPHMICKGDTQYSDGTGNDDTGLDFAAAPDIDHLNPQVQKEL
SDWMNWLKTEIGFDGWRFDFVRGYAPSITKIYMENTSPDFAVGEFWNSIAYGGDGKPDYN
QDNHRNELAGWVQNGGGAVTTFDFTTKGILQAAVEGELWRLKDSNGKPPGLIGILPQNAV
TFIDNHDTGSTQKLWPFPSDKVMQGYAYILTHPGIPSVFYDHFFDWGLKDGISTLVSIRN
RNGISATSNVQIMAANADLYVAMVDKKIIVKIGPKTDLGSLIPPNYQVATSGQDYAVWEQ
KS
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgaattccctttttcctctttgtttaattctctctctttttcctatatttgcaactcca
actttgttgtttcaggggttcaattgggaatcaagtaatcagcaaggtggatggtacaac
tctcttatcaatttagttccagatttggcaaaagctggagttactcatgtttggttacca
ccatcatctaactctgtttcccctcaaggttatatgccaggaagattgtatgacttagat
acatctaagtatgggaatcagcaacaactgcaagctcttattaaggctttacatgatcag
ggaataaaagttgttgctgatatagtaataaaccacagatgtgctgataagaaagatagc
agaggaatatactgcatctttgaaggcggaacgtctgatgatcgtcttgattggggtccg
catatgatctgcaaaggcgatacgcaatattctgatggtacagggaatgatgacaccggt
ttagactttgcagctgcacctgatatcgatcatcttaacccccaagtccaaaaagagtta
tcagactggatgaattggctaaaaactgaaattggatttgatggttggcgtttcgatttt
gttagagggtatgctcctagcattaccaagatttatatggaaaacacttccccggatttt
gcagttggtgaattttggaattctattgcctatggcggggatggaaaaccggactataac
caggataatcataggaatgagctagccggatgggttcaaaatgggggcggggctgtaaca
acgtttgatttcacgactaagggaattcttcaagctgctgttgaaggggagttgtggaga
ttgaaggattcaaatggtaaacctcctggtttgataggtattttgcctcagaatgctgtg
acttttatcgataatcatgatactggatcgacacaaaagctttggcctttcccttcagac
aaagttatgcaaggctatgcatatattctcacacatccgggaattccctcagtgttttat
gatcatttctttgattggggactaaaggacggaatttctacgttggtgtcaataaggaat
aggaatggaatatctgcaacaagtaatgtgcagataatggctgctaatgctgatctttat
gtagcaatggttgataagaagattattgtgaaaattggtccaaaaactgatcttggaagt
cttatcccacctaattatcaggtggcaacttctggacaagactatgctgtatgggagcaa
aagtcataa

DBGET integrated database retrieval system