KEGG   Nicotiana tomentosiformis: 104086304Help
Entry
104086304         CDS       T05025                                 

Definition
(RefSeq) DNA ligase 1
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
nto  Nicotiana tomentosiformis
Pathway
nto03030  DNA replication
nto03410  Base excision repair
nto03420  Nucleotide excision repair
nto03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:nto00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    104086304
   03410 Base excision repair
    104086304
   03420 Nucleotide excision repair
    104086304
   03430 Mismatch repair
    104086304
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:nto03032]
    104086304
   03400 DNA repair and recombination proteins [BR:nto03400]
    104086304
Enzymes [BR:nto01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     104086304
    6.5.1.6  DNA ligase (ATP or NAD+)
     104086304
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     104086304
DNA replication proteins [BR:nto03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    104086304
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     104086304
DNA repair and recombination proteins [BR:nto03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     104086304
   NER (nucleotide excision repair)
    Other NER factors
     104086304
   MMR (mismatch excision repair)
    Other MMR factors
     104086304
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C RNA_ligase
Motif
Other DBs
NCBI-GeneID: 104086304
NCBI-ProteinID: XP_009588837
LinkDB All DBs
Position
Unknown
AA seq 775 aa AA seqDB search
MLPLRSCCHHFTQPSLYNRLHFSLKLSSLFLLIPPFNPLKTLRPLFLNPNSRTMSTRRSA
FDVLMANSKKKTPTQDSSPKKRKTPEAETSNKTAILENHNQDSILKPNEDTHLVNESKSE
EVLVKKQKMISPDESVTELKKKAANFDPRKAAYWGNGERVPFMFVVKAFDAISKESGRIV
ITEIVTNMLRTVIETTPEDLLPVVYLSANKIAAAHDGLELGIGDASIIKALAEACGTKEA
HIKKQYKELGDLGLVAKASRSSQPLMRKPEALTVAKVFDTFRIIAKESGKDSQEKKKNYI
KSLLVAATDCEPQYLIRLLQTKLRIGLAEQTLLVALAHASVYSDAHSSPPAGVDSPLEEA
AKIVKQVYSVIPVYEKVVPAILADGVWKLSETCSFSPGVPVGPMLAKPTKGVSEILDKFQ
DMEFTCEYKYDGERAQIHYLEDGSVEIYSRNAERNTGKFPDVVAAISRLKKSSATSFVLD
CELVAYDREKQKILPFQILSTRARKNVVMNDIKVNVCIYAFDILYLNGQPLLQEQLNVRR
EHLYTSFEEEPGYFQFATAVTSNDLEEITKFLEAAVNDSNEGLIIKTLSRDATYEPSKRS
NNWLKLKKDYMESIGDSLDLVPIAAFHGRGKRTGVYGAFLLACYDSNNEEFQSICKIGTG
FSEAMLEERSSSLRSKVIPKPKSYYRYAETINPDVWFEPTEVWEVKAADLTISPVHRAAQ
GIVDRDKGISLRFPRLIRVREDKNPEQASSADMVADMFNAQKHNHKNDKDDNEEE
NT seq 2328 nt NT seq  +upstreamnt  +downstreamnt
atgttgccgttgcgctcatgctgtcaccatttcactcaaccttctctttacaaccgtctc
catttctcccttaaactctcttccctctttctccttatacccccctttaatccccttaaa
acccttagaccccttttcttaaaccctaattcaagaaccatgtccactcgtcgctctgcc
ttcgatgttcttatggcaaattccaagaagaaaaccccaacacaagattcctcacccaag
aaacgcaaaaccccagaagctgaaacttccaataaaactgctattcttgaaaatcataat
caagattcaattttgaagccaaatgaggacacccatttggttaatgagtcgaaaagtgaa
gaggttttggtgaagaaacagaagatgataagtccagatgagagtgtgactgagctgaag
aaaaaagctgccaactttgatccaagaaaggctgcatattgggggaatggtgagagagtg
ccattcatgtttgtagttaaggcgttcgacgcaatttcgaaggagtcaggaagaattgta
attactgaaattgtgacaaatatgttgaggactgtgattgagacgacacccgaggatttg
ttgcctgttgtgtacctttcggctaacaagattgcagctgcacatgatggtttggagctt
ggtattggagatgcttctattatcaaggcacttgctgaagcttgtggcactaaagaagca
catattaagaagcaatataaggagcttggagacttgggccttgttgcaaaagcaagccgt
tcatcacagcctctgatgcgtaaaccagaagcattgactgttgccaaagtttttgacacg
tttcgaattattgccaaggaatctgggaaggatagtcaggaaaagaaaaagaattacatt
aaatcactacttgttgcagctactgattgtgaaccccaatatttgattcgcctcctccag
acaaagctacgcattggtttggctgaacaaacactgttagtcgcacttgctcatgcttct
gtgtactcggatgcgcattcatcacctcctgcaggtgtagattctcctttggaagaggca
gccaagattgtaaagcaagtgtactctgtaattccggtttatgaaaaagttgttcctgct
atactagctgatggtgtttggaagctttcagaaacatgcagcttctcacctggtgttccg
gttggacctatgctagctaagccaaccaaaggagtatctgaaattcttgataagtttcaa
gatatggagttcacatgtgaatacaagtatgacggtgaacgtgctcagatacattacttg
gaagatggttctgttgagatatacagccgaaatgcagaaagaaatactggaaagtttcct
gacgttgttgctgctatctcaagattgaaaaaatcttctgcaacatcatttgttcttgat
tgtgaactggtcgcatatgaccgtgagaaacagaagatcctgccctttcagatcctcagt
acgcgtgctcgtaagaatgttgtcatgaatgatatcaaggtcaacgtttgcatatatgct
tttgatatcttgtatcttaatggacaaccacttcttcaagagcaacttaatgtgcgcaga
gagcatctttacacgtcatttgaagaagaacccggatatttccaatttgctacagctgta
acctcaaacgatcttgaagaaataacaaaatttcttgaagctgcagtgaatgacagtaat
gagggattgattatcaagacactaagtagagatgctacatatgagccttcaaaacggtca
aataattggctaaaactgaagaaggactacatggaaagtattggtgactcactggatttg
gtaccaattgctgcttttcatggtcgggggaaacgtactggtgtttacggagcctttctc
ctagcttgttatgatagcaacaacgaggagttccagagcatctgtaaaattggaactgga
ttttctgaagcaatgcttgaagaacgctcttccagccttcgttccaaagttattccgaaa
ccaaagtcatattacaggtatgcggaaaccatcaatccagatgtatggtttgaacctacc
gaggtatgggaagtgaaagcagctgatcttaccatcagccctgtccaccgtgctgcgcaa
ggtatcgtggatcgcgataagggaatttctttaagatttccacgtttgattcgtgtacga
gaagacaagaatcctgagcaggcctcatcagcagacatggttgcggatatgttcaatgct
cagaagcataatcataaaaatgataaggatgataatgaagaagaataa

DBGET integrated database retrieval system