KEGG   Nicotiana tomentosiformis: 104093002Help
Entry
104093002         CDS       T05025                                 

Definition
(RefSeq) serine/threonine-protein kinase GRIK2-like isoform X1
  KO
K00908  calcium/calmodulin-dependent protein kinase kinase 1 [EC:2.7.11.17]
Organism
nto  Nicotiana tomentosiformis
Brite
KEGG Orthology (KO) [BR:nto00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:nto01001]
    104093002
Enzymes [BR:nto01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     104093002
Protein kinases [BR:nto01001]
 Serine/threonine kinases: Other
  CAMKK family
   104093002
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like APH Seadorna_VP7 Pkinase_fungal RIO1
Motif
Other DBs
NCBI-GeneID: 104093002
NCBI-ProteinID: XP_009596998
LinkDB All DBs
Position
Unknown
AA seq 442 aa AA seqDB search
MLIFRCGDQIVIGLYSVVITTFCSFLMFVKGHSVAKVTEMGCCGCFGFCFARKPKRVGRP
NLGLSNNCSQESLLYEEGEEEDGCSYNGDVTDTGNGDDGEYRSPVKRSEEILMYRAQNGL
VCREIPVKETHKVTRDEDEDGNKMVNEYVREYKIGSGSYGKVVLYRSRTDGKHYAIKAFR
KSHLLKLRVAPSETAMSDVLREVLIMKMLCHPNIVNLIEVIDDPTTDHFYMVLEYVEGKW
VCEGAGPAGGLGEHKARTYLRDTVSGLMYLHSHNIIHGDIKPDNLLVTASGRVKIGDFSV
SQAFEDDNDELRRSPGTPVFTAPECCLGLTYHGKAADTWAVGVTLYCMVLGKYPFLGDTL
QDTYDKIVNNSLALPDGMNPLLKNLLEGLLCKDPAQRITLKSVSEHEWVVGNEGPIPQHL
CWCQRKKLQKEESDGRMEDTFT
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atgctaattttcaggtgtggggatcaaattgttatcgggttgtatagtgtagtcattaca
actttctgtagtttcttgatgttcgtgaaggggcattctgttgctaaagtgacagaaatg
gggtgctgtgggtgttttgggttctgttttgctaggaaaccaaagagggtgggaaggccc
aatttgggattgtccaataactgttctcaggagtctttgttgtatgaagagggggaggaa
gaagatggttgctcctacaatggtgatgtaactgatactggtaatggggatgatggtgag
tatcgcagcccagtcaaacgctctgaagagattctcatgtacagagctcaaaatgggttg
gtttgtagggagatccctgtcaaggaaacccacaaagtcacacgggatgaggatgaagat
gggaacaagatggttaatgagtatgtacgtgaatataagattggttctggtagctatgga
aaagtggttctatatcggagccgtactgacggaaaacattatgccattaaggcctttcgc
aagtctcatttattaaaattgcgtgtggcaccttcagaaactgctatgtcggatgttctt
cgtgaggttctgatcatgaaaatgctgtgccatcccaatatagttaatcttattgaggtg
attgatgacccaacaacggatcacttctacatggttcttgaatacgttgaaggaaaatgg
gtctgtgagggtgctggtccggcaggtggtctcggagaacataaggcacggacgtacttg
cgcgacacggtatccggcttgatgtatctacattctcataatataatccatggggatatt
aagccagacaatcttttagttacggcctctggcagggtgaagattggtgatttcagcgtt
agccaagcttttgaggatgataatgatgagcttaggcggtctcctggcactccggttttt
actgctcccgagtgctgtttaggactaacatatcatggaaaagctgctgatacatgggca
gttggtgtcaccctttactgtatggttttaggaaaatacccatttctaggagacacactc
caggacacatatgacaagatagtaaataactccctcgctctccctgatggtatgaatccg
ctgctgaagaatttgcttgaggggcttctttgtaaagatccagcacaaaggataacactc
aagagtgtgtccgagcacgaatgggttgtcggaaatgaaggtcccatccctcagcatcta
tgttggtgccagcgcaaaaaattacaaaaggaagaatctgatgggagaatggaggatact
ttcacttga

DBGET integrated database retrieval system