KEGG   Nicotiana tomentosiformis: 104096705Help
Entry
104096705         CDS       T05025                                 

Definition
(RefSeq) uncharacterized protein LOC104096705
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
nto  Nicotiana tomentosiformis
Pathway
nto00061  Fatty acid biosynthesis
nto00780  Biotin metabolism
nto01100  Metabolic pathways
nto01212  Fatty acid metabolism
Module
nto_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:nto00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    104096705
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    104096705
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:nto01004]
    104096705
Enzymes [BR:nto01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     104096705
Lipid biosynthesis proteins [BR:nto01004]
 Fatty acid synthase
  Component type
   104096705
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FabA MaoC_dehydratas 4HBT MaoC_dehydrat_N
Motif
Other DBs
NCBI-GeneID: 104096705
NCBI-ProteinID: XP_009601414
LinkDB All DBs
Position
Unknown
AA seq 224 aa AA seqDB search
MASTVLSQSLFSTLSSHRNLENGSLPLKRSMLKQSLVVSRSHSLKNHFKNSFITNCASPE
NDATSKSETPIELRYPAFPTVMDINQIREILPHRFPFLLVDRVIEYNPGVSAVAIKNVTI
NDNFFPGHFPERPIMPGVLMVEAMAQVGGIVMLQPEVGGSRENFFFAGVDKVRFRKPVVA
GDTLVMRMTLIKLQKRFGIAKMEGKAYVGADVVCEGEFLMAMGS
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atggcttctacagttctgtcacaatctctcttctccactctcagttctcacagaaacctt
gagaatggctcacttcctttgaaaagatcaatgctcaaacaatcacttgttgtctcaaga
tcacattccttgaaaaaccatttcaagaatagcttcatcaccaactgtgcctctcctgaa
aatgatgcaacttccaaatctgaaaccccaattgaattgaggtacccagcatttcctact
gtgatggatatcaatcagattcgtgagattttgccccatcgttttccatttctactagtg
gatagagtgattgaatacaatccgggagtatcagctgtggctataaagaatgtgacaatt
aatgacaatttttttcctggtcatttccctgagaggccaatcatgcctggtgtcctcatg
gttgaggcaatggcacaagttggtggcatagttatgctccaacctgaagtgggaggctcc
cgggagaatttctttttcgctggagtagacaaagtgaggttcaggaagccagtggtggcc
ggagatactttggtaatgagaatgacactgatcaagctgcaaaaacgtttcggaattgca
aaaatggaagggaaggcatatgtaggagcggatgtggtttgtgagggtgagttcttgatg
gctatgggcagttaa

DBGET integrated database retrieval system