KEGG   Nicotiana tomentosiformis: 104098299Help
Entry
104098299         CDS       T05025                                 

Definition
(RefSeq) phosphoenolpyruvate carboxylase-like
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
nto  Nicotiana tomentosiformis
Pathway
nto00620  Pyruvate metabolism
nto00710  Carbon fixation in photosynthetic organisms
nto01100  Metabolic pathways
nto01200  Carbon metabolism
Module
nto_M00168  CAM (Crassulacean acid metabolism), dark
nto_M00170  C4-dicarboxylic acid cycle, phosphoenolpyruvate carboxykinase type
nto_M00171  C4-dicarboxylic acid cycle, NAD - malic enzyme type
nto_M00172  C4-dicarboxylic acid cycle, NADP - malic enzyme type
Brite
KEGG Orthology (KO) [BR:nto00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    104098299
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    104098299
Enzymes [BR:nto01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     104098299
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-GeneID: 104098299
NCBI-ProteinID: XP_009603289
LinkDB All DBs
Position
Unknown
AA seq 964 aa AA seqDB search
MSRKIEKMASIDAQLRLLAPAKVSEDDKLVEYDALLLDRFLDILQDLHGEDIRETVQACY
ELSAEYEGKHDPQKLEELGRMLTSLDAGDSIVVTKAFSNMLNLANLAEEVQIAYRRRSKL
KKRDFSDEASALTESDIEETLRKLVGQLNKSPQEVFDALKNQTVDLVLTAHPTQSVRRSL
LQKHARVRDCLTQLYAKDITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGMS
YFHETIWKGVPKFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTRD
VCLLARMMAAKLYFSQIEDLMFELSMWRCNDELRARADELHRTSKRDTKHYIEFWKQIPS
NEPYRVLLADVRDKLYNTRERARQLLANGYSDVSEESTFTNVEQFLEPLELCYRSLCACG
DRPIADGSLLDFLRQVSTFGLSLVRLDIRQESERHTDVLDAITRHLGIGSYKEWSEEQRQ
EWLLSELSGKRPLFGPDLPKTDEITDVLDTFNVIAELPADNFGAYIISMATAPSDVLAVE
LLQRECHVKSPLRVVPLFEKLADLESAPAAVARLFSIDWYRNRINGKQEVMIGYSDSGKD
AGRLSAAWQLYKAQEELVNVAKEFGVKLTMFHGRGGTVGRGGGPTHLAILSQPPDTIHGS
LRVTVQGEVIEQSFGEEHLCFRTLQRFTAATLEHGMNPPVAPKPEWRALLDEMSVVATKE
YRSLVFQDPRFVEYFRLATPELEYGRMNIGSRPAKRKPSGGIESLRAIPWIFAWTQTRFH
LPVWLGFGVAFKHIIEKDIRNLQMLKDMYNGWPFFRVTLDLIEMVFAKGDPGIAALYDKL
LVSEDLWPLGERLRSKYEETKSFLLQVAGHKDLLEGDPYLRQRLKLRDSYITTLNVCQAY
TLKRIRDPSYNVKVRPHLDKEIMESSKPAAELVKLNPMSEYAPGLEDTLILTMKGIAAGM
QNTG
NT seq 2895 nt NT seq  +upstreamnt  +downstreamnt
atgagcaggaaaattgagaagatggcatcgatagatgcacaactgaggctattggcacca
gcaaaagtgtcggaggatgataaacttgtggagtatgatgctttattgcttgaccgtttt
cttgatattttgcaggatttgcatggcgaggatattcgtgaaacggttcaagcgtgttat
gaactttctgctgaatacgaagggaagcatgaccctcagaagttggaagagcttgggaga
atgcttaccagtttggatgctggagattccattgtagttactaaagctttctctaacatg
cttaacttggcaaaccttgccgaagaggttcagatagcttacagacgaagaagcaagcta
aaaaagcgtgatttttcggatgaggcttctgcactaactgaatcagacattgaagagacc
cttaggaagcttgtcggacagctaaacaaatcgccacaagaagtttttgatgctttgaag
aaccagactgttgatttggtgctaacagcacatcctactcagtctgttcgtaggtctttg
cttcagaagcatgcaagggttcgtgattgtttgacgcagttgtatgcgaaagatattact
cctgatgataagcaggagctagacgaggctctacaaagagagattcaagcagcatttcgc
acagatgaaatcaggaggactccgccaactccacaagatgagatgagggcagggatgagt
tacttccatgagacaatatggaaaggggtgccgaaattcctacgccgtgttgacactgct
ttgaagaatattggaataaatgagcgtgttccctacaatgcccctctcattcagttttct
tcttggatgggtggtgatcgagacggcaaccctagagtaacccctgaagtgacaagagat
gtgtgcttattggctagaatgatggctgcaaaactgtatttctctcagattgaggatctt
atgtttgagctttcaatgtggcgatgcaatgatgagctccgtgcacgtgcagatgagctt
cataggacttccaaaagagatacaaagcactacattgagttttggaagcaaattccatcg
aatgagccctaccgtgttcttcttgctgatgtgagagataagttatataatacacgggaa
cgcgcgcgtcagttactagccaatgggtactctgatgtttctgaggagtcaacattcaca
aatgttgaacagttcctggagcctctggagctgtgctatagatctctatgcgcttgcggt
gacagaccaattgcagatggcagccttcttgattttctaaggcaagtttccacctttggt
ctctcccttgtgagacttgatatccgccaagagtcagagaggcacactgacgttctagat
gctataacaaggcacctgggtattggatcctataaagaatggtctgaagagcagagacag
gaatggctcttatctgaactaagtggaaagcgtccactgtttggacctgatctccctaaa
actgatgaaatcactgatgttttggatacctttaatgtcattgcggaacttcctgccgat
aattttggtgcttatattatttcaatggccacggcaccctctgatgtgcttgccgttgag
cttttgcagcgtgaatgtcatgtaaaaagtccattgagggttgtcccgttgtttgaaaag
cttgctgatcttgagtctgcacctgctgccgttgctcggttgttctccatagattggtac
agaaaccgtatcaatgggaaacaagaagttatgattgggtattctgattcaggtaaggat
gctggccgactatctgcagcttggcaattgtacaaggctcaagaggaacttgtaaacgtg
gcgaaagaatttggagtgaagctaacaatgtttcatggccgaggagggactgttggacgg
ggagggggtcccacccaccttgccattttatcacaacctcctgacacaatccacggttca
cttcgtgtgactgttcaaggtgaagttattgaacaatcgtttggggaggaacacctgtgc
ttcagaactcttcagcgtttcacagcagctacacttgagcatggaatgaacccccctgtg
gctccgaagccagagtggcgtgctctattggatgagatgtctgttgttgctacgaaagag
tatcggtctttggtgttccaggatccacgatttgttgaatacttccgccttgcaacccca
gaattagaatatggtcgcatgaatattggaagtcgccccgcaaaaaggaagccaagtggt
gggatcgaatctcttcgagcaattccatggatcttcgcatggactcagacaaggtttcat
ctccctgtctggcttggctttggggttgcattcaagcatattattgagaaggatataaga
aatctgcaaatgctcaaggatatgtacaatggatggcctttcttcagagtgacacttgac
ttgattgaaatggtctttgctaagggagatcctggtattgctgcattgtatgataagctt
ttagtatctgaagatctgtggccgcttggagagcgcttgaggtccaaatatgaagaaaca
aagagctttctccttcaggttgctgggcataaggatcttttggaaggagatccatacttg
aggcagagactcaaacttcgcgattcttacattacaaccctcaatgtttgtcaagcctac
acattgaagcgaattcgcgaccccagctacaatgtgaaggtgcggccacatctagataag
gagataatggaatcaagtaaaccggctgctgagttagtgaagcttaatcctatgagtgag
tatgctcctggattggaagacacacttattttgacaatgaaaggtattgctgctggaatg
cagaacactggttaa

DBGET integrated database retrieval system