KEGG   Nicotiana tomentosiformis: 104099284Help
Entry
104099284         CDS       T05025                                 

Definition
(RefSeq) uncharacterized protein LOC104099284
Organism
nto  Nicotiana tomentosiformis
SSDB OrthologParalogGFIT
Motif
Pfam: NMO FMN_dh IMPDH
Motif
Other DBs
NCBI-GeneID: 104099284
NCBI-ProteinID: XP_009604521
LinkDB All DBs
Position
Unknown
AA seq 333 aa AA seqDB search
MGWRGILGFEYGIVQAPLGPDISGPELVAAVANAGALALLRAPDWEDPDRVRELIRKTRT
LTNKPFGIGVVLAFPHKENLKAILDEKVAVLQLYWGECSKELVLEAHNAGVKVVPQIGSY
EEAKKAADAGVDALIVQGREAGGHVAGQDGLITLLPRVVDLVCGRDIAVIAAGGIVDERG
YVAALALGAQGVSLGTRFLTTEESYAHPTYKRKLIEFEQTEYTDLFGRARWPGAPHRVLA
TPFFKEWKALPSHENETNQPVIGRTIIHGKEREVRRFAGTVPNASTTGDIESMAMYAGQS
IGLIKEILPAGEVIKRIVERAQRLIDQQFAPVN
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgggttggagagggatattgggatttgagtatgggattgtgcaggcacccttaggacca
gatatatcaggtccagagcttgttgctgctgttgctaatgctggtgctctcgctcttctt
agagcccctgattgggaagatcctgatcgtgtgagggagctcataaggaaaacaagaacc
ttgactaacaaaccatttgggataggtgtagttcttgcatttcctcacaaggaaaattta
aaggctatattggatgagaaggttgcagtattacagctttattggggtgaatgctcaaaa
gagttggttcttgaagctcataatgctggggtcaaggttgtaccccaaattggcagctat
gaagaagcaaagaaagccgcagatgctggtgtagatgcacttattgtccaaggtcgggaa
gcaggaggccatgttgctggccaggatggtttaattaccttattgcctagagttgtcgat
cttgtttgtggtcgtgacattgcagtaattgctgctggaggaattgtggacgagcgtggt
tatgttgctgctctggcccttggtgcacagggtgtgtcattaggcactaggtttctcaca
acagaggaaagctatgcgcacccaacatacaagaggaagctcattgaatttgagcaaacg
gaatacacggacttatttggtcgcgcaaggtggccaggggcaccacatcgcgttctggca
accccgttcttcaaggaatggaaggcgctcccaagtcatgagaatgagacaaatcaaccg
gtcattggccgcacaatcatacacggcaaggaaagagaggttcgtcgctttgctggtaca
gttccaaatgcctcaactacgggagatatcgaaagcatggcaatgtatgctggtcagagc
attggtcttataaaggaaattctacctgcaggtgaagtgataaagaggatagttgaaagg
gctcaacgactgattgatcaacaatttgcgcccgtgaattaa

DBGET integrated database retrieval system