KEGG   Nicotiana tomentosiformis: 104099979Help
Entry
104099979         CDS       T05025                                 

Definition
(RefSeq) DNA ligase 6 isoform X1
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
nto  Nicotiana tomentosiformis
Pathway
nto03030  DNA replication
nto03410  Base excision repair
nto03420  Nucleotide excision repair
nto03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:nto00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    104099979
   03410 Base excision repair
    104099979
   03420 Nucleotide excision repair
    104099979
   03430 Mismatch repair
    104099979
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:nto03032]
    104099979
   03400 DNA repair and recombination proteins [BR:nto03400]
    104099979
Enzymes [BR:nto01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     104099979
    6.5.1.6  DNA ligase (ATP or NAD+)
     104099979
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     104099979
DNA replication proteins [BR:nto03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    104099979
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     104099979
DNA repair and recombination proteins [BR:nto03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     104099979
   NER (nucleotide excision repair)
    Other NER factors
     104099979
   MMR (mismatch excision repair)
    Other MMR factors
     104099979
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_N DNA_ligase_A_M DRMBL RMMBL Lactamase_B_2
Motif
Other DBs
NCBI-GeneID: 104099979
NCBI-ProteinID: XP_009605414
LinkDB All DBs
Position
Unknown
AA seq 1177 aa AA seqDB search
MSSDAGTLTLDSTTLYTTALNSLPGQSSSHSNPPPLPLPPIPPSVPQPKLIPKTRFIIDG
FKYAGDFSVSYFLSHFHSDHYTGLSPNWSKGIIFCSSITANLLIQVLNVPAQFVVSLPLS
EAVLVDGSEVFLIDANHCPGAVQFLFKIPVNYGKFERYIHTGDFRYCDKMKLEPVLNAFI
GADAVFLDTTYCNPKFIFPSQDESIDYIVGVIEKYGVENEGSLKNILFIIATYVIGKEKI
LVEVARRCKRKIHVDGRKVAVLKVLGRGEDGMFTTFESKTDVHVVGWNVLGETWPYFRPN
FVKMNEIMNEKGYSKVVGFVPTGWTYEVKRNKFSVRKKDSFEIHLVPYSEHSNYDELRQY
VKFLKPKRVIPTVGIDVEKLDSKHANAMRKHFAGLVDEMAIKQEFLMGFHPCVQGEEDMD
AKESPHASVSITNQENTGKSAHALVSITKQENEDMSVDSKICNIGDREDIIHSFPQGEPE
LQGLEKISEGDVEEELKELKDCLPIWVTKDQMLDLLSISGKNIVDAVTNFYEHETEYRER
VTVSNSPTSSFEPNSPNGSALPFKPKGDESMLSPKPWVGKMPQQGETTASNKTFKLANMN
RSSCKTISPGKRKRSAENKSLKKARGNVSMEPGGSKQCTITKFFSKMAPPSVQKWNDATA
SKNSHDDNSMLLSASFESYKEEADRFIQIVNADESLRSYAATVLAKTKGDISMALDIYFS
EHKDVGETNGCRISESSKVVQPVKEVFPSSKDEKSPKRLGDDPDWSLSGVPLANTGVNYV
SLPPEKYSPLEHASWNKGQAAPYLHLSRTFELVEEEKGKIKATSMLCNMFRSLLALSPED
VLPAVYLCTNKIAPDHENMELNIGGNTVIAALEEACGKKRSKVRELYNSLGDLGDVAQLC
RQTQSLLAPPMALTIRGVYSTLRRISLQAGSGSGIRKKSLIVKLMCSCREKEMKFLVRTL
VRNLRIGAMMRTVLPALAQAIVFNSVLYDGSVENMKENLQRLSAEVVEAYNILPSLDVLV
PSLMEKGIEFSLNTLSMDPGIPIKPMLAKITNGTPQVLKLFQNKTFTCEYKYDGQRAQIH
KLADGSVRVFSRNGDETTSRFPDLVNIITESCGPRGATFIVDAEVVAIDRKNGSKLMSFQ
ELSSRERGTKDSIIALDKIKVEICIFVFDIMFANGEQ
NT seq 3534 nt NT seq  +upstreamnt  +downstreamnt
atgtcctccgatgccggaaccctaacccttgactctaccactctctacacaaccgctctc
aactccctccccggccaatcttcctcacattcaaacccaccacccctccctcttccccca
atccctccctcagtccctcaaccgaaactgattccaaaaactcgctttatcatcgacggt
ttcaaatacgccggcgatttctcagtttcatacttcctctctcatttccactccgatcac
tatactggcctttcccctaattggtccaaaggtatcattttctgctcctccataaccgct
aaccttctcatccaagtcctcaatgttcctgcgcaatttgtagtgtctttaccgctctcc
gaagccgttttagtcgacggctccgaggtatttctcatcgacgccaatcattgtcctggt
gctgtgcaatttttatttaaaattccagttaattatggcaaatttgagcggtatattcac
acaggtgattttcgttattgtgacaaaatgaaattagagcctgttttaaatgcatttatt
ggtgctgatgctgtatttttagatacaacttactgtaatccgaaatttatattccctagt
caagatgagtcaattgattatatagttggtgttatagagaaatatggagttgagaacgag
ggttcattgaaaaatatattgtttattattgctacttatgttattgggaaggagaagatt
ttagtggaggttgcgcggagatgtaagagaaagatccacgtcgatggcaggaaagtagca
gttttgaaggtattaggtcgtggggaggatgggatgtttactacctttgaatctaaaacc
gatgttcatgttgttgggtggaatgtgttgggtgagacttggccatatttcagacccaat
tttgtgaaaatgaacgagatcatgaatgaaaaagggtattctaaggtggttggttttgtc
ccaactggctggacttatgaagtgaagcgaaataagttttcagtgaggaagaaagattcc
tttgagatacatcttgttccatatagtgaacattctaattatgatgagcttagacaatat
gtgaagtttctgaaaccaaaacgtgtcataccaacagtaggcatagatgttgagaagctg
gatagcaaacatgctaatgccatgcggaagcattttgctggcttggtcgatgagatggcc
attaagcaagaatttctaatgggttttcatccttgtgtccaaggggaggaagatatggat
gcaaaagaatctcctcatgcttcagttagtatcaccaatcaagaaaacacaggcaaatct
gctcatgctttagttagtatcaccaagcaagaaaatgaggatatgtcagtggattctaag
atctgcaatattggtgatagggaggatattatccattcatttcctcaaggagaacctgag
ttgcaaggtttagaaaaaataagtgaaggtgatgtggaagaagagctgaaagagcttaaa
gactgtttacccatttgggtcactaaagaccagatgttggatttacttagtatttcggga
aaaaatattgttgatgcagtcactaacttttatgaacatgaaaccgaataccgcgaacgg
gtcactgtcagtaattctcctacctcttcatttgagccaaactcaccaaatgggtctgca
ttgccttttaaaccaaaaggagatgaatctatgctgtctcccaaaccatgggttggtaaa
atgccgcagcagggtgagacaactgcatcaaataaaacctttaaactggccaacatgaac
cgttccagttgcaaaactatttctccgggtaaaaggaagagaagtgctgaaaacaagtcg
cttaaaaaagcaagaggaaatgtaagtatggaacctggtggatcaaagcagtgtactata
acaaagttcttcagtaaaatggctcctccatccgtgcagaaatggaatgatgcaactgct
agtaaaaattcccacgatgataacagtatgctactaagtgcctcctttgagtcttataaa
gaggaagctgatcggtttattcagattgtgaatgcagatgagtcattaagaagttatgct
gccacagtactagcaaagactaaaggagacataagtatggcacttgatatttatttttca
gaacacaaagatgttggagaaactaatggatgcaggatttctgaaagcagcaaagtggtg
caacctgttaaagaggttttcccttcttccaaagatgaaaagtcgcccaaaagattagga
gatgacccggattggtccttgtctggagttcccttagccaatactggcgtaaattatgta
tcacttccacctgagaaatattctcctttggaacatgctagctggaacaaggggcaggct
gctccatacctacatctttcacggacttttgaattggtagaggaagaaaaaggcaagata
aaagcaacatcaatgttatgcaatatgtttcggagcttgctggcattgtctcctgaggat
gtgcttcctgcagtgtacttgtgcacaaacaagatagctcctgaccatgaaaatatggaa
ttgaatattgggggcaatactgttatagcagcactagaggaggcatgcgggaaaaagaga
tcgaaagtacgagaattatataacagcttaggtgatcttggtgatgttgctcaactttgc
cgacaaacacaatcgttacttgctcctccaatggcacttacaattaggggtgtatactct
actcttagaaggataagtttacaggcagggagtgggagtggcatccgaaagaaaagcctc
attgtcaaactcatgtgttcatgtagggagaaggagatgaagtttcttgtccgaactttg
gttaggaatttgcggattggagccatgatgagaactgttcttcctgcattagctcaagct
attgtcttcaattctgttctttatgatggatcagtcgaaaatatgaaagagaatctgcag
cgactttcagcagaagtagttgaggcatataacatccttcctagcttggatgtacttgtt
ccttctttgatggaaaaggggattgagttttccttaaatacgttgtcaatggatccaggc
atacccatcaaaccaatgcttgcaaaaattactaatggcacccctcaagtgctgaagctc
ttccaaaacaaaacctttacatgcgagtacaaatatgatggtcagcgagctcaaattcat
aaattagctgatggttcggttcgtgtattttcacggaatggggatgaaacaacatctaga
ttccctgatttggtaaacataattacagaatcatgtggtcccagaggagcgacattcata
gtggatgcagaggttgttgcaattgatagaaaaaatggttcaaagctcatgtcgttccaa
gaactatcttcacgagagagagggaccaaagattccatcatcgcattagataaaattaag
gttgagatatgcatttttgtcttcgatatcatgtttgcaaatggagaacagtaa

DBGET integrated database retrieval system