KEGG   Nicotiana tomentosiformis: 104100886Help
Entry
104100886         CDS       T05025                                 

Definition
(RefSeq) alanine aminotransferase 2
  KO
K00814  alanine transaminase [EC:2.6.1.2]
Organism
nto  Nicotiana tomentosiformis
Pathway
nto00220  Arginine biosynthesis
nto00250  Alanine, aspartate and glutamate metabolism
nto00710  Carbon fixation in photosynthetic organisms
nto01100  Metabolic pathways
nto01200  Carbon metabolism
nto01210  2-Oxocarboxylic acid metabolism
nto01230  Biosynthesis of amino acids
Module
nto_M00171  C4-dicarboxylic acid cycle, NAD - malic enzyme type
Brite
KEGG Orthology (KO) [BR:nto00001]
 Metabolism
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    104100886
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    104100886
   00220 Arginine biosynthesis
    104100886
Enzymes [BR:nto01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     104100886
Amino acid related enzymes [BR:nto01007]
 Aminotransferase (transaminase)
  Class I
   104100886
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_1_2 Beta_elim_lyase
Motif
Other DBs
NCBI-GeneID: 104100886
NCBI-ProteinID: XP_009606549
LinkDB All DBs
Position
Unknown
AA seq 545 aa AA seqDB search
MRRFVADKAKNLITKTRTTYSSPSSSTTTCVLQRRTSSPQSASVLRFLSILHTAPSDSMA
SDYSSTPVTLNNLNPKVLKCEYAVRGEIVNLAQKLHQDLKDNPGSHPFDEILYCNIGNPQ
SLAQQPITFFREALALCDHPVILDKSETQGLFSADSIERAFQILDQIPGRATGAYSHSQG
VKGLRDTIASGIEARDGFPADPNDIFLTDGASPAVHMMMQLLIGSENDGILCPIPQYPLY
SASIALHGGTLVPYYLDEETGWGLEISELENQLKTAKSKGIKVRALVVINPGNPTGQVLA
EANQRDIVKFCKKEGLVLLADEVYQENVYVPEKQFHSFKKIARSMGFGEKDISLVSFQSV
SKGFYGECGKRGGYMEVTGFSPEIREQIYKVASVNLCSNISGQILASLVMSPPKVGDESY
ESFSAEKEAILSSLARRAKTLEDAFNSLEGVTCNKAEGAMYLFPRINLPAKAIKAAEEAK
TAPDAFYARRLLNATGIVVVPGSGFGQRPGTWHFRCTILPQEEKIPAIVSSLTDFHKQFM
DEFRG
NT seq 1638 nt NT seq  +upstreamnt  +downstreamnt
atgcggagattcgtagctgacaaagccaaaaatctcatcactaaaaccaggaccacctat
tcttctcctagtagtagtactactacttgcgtgttacaacgccgcacctcttcccctcaa
tcagcttctgttcttcgtttcttgtccattcttcacacagctccttctgattcaatggct
tccgattattcatctactccggtgactcttaacaaccttaatccaaaggttttgaaatgt
gagtatgctgtccgtggagaaattgtcaaccttgctcagaaattacatcaagacctcaag
gataatccaggctctcatccctttgatgagatattatactgcaatattggaaatcctcaa
tccttggctcagcagcctattactttctttagggaggcccttgcattatgtgaccatcca
gttattttggacaaaagtgaaacacaaggtctgttcagtgcggattcaattgaacgagct
ttccagatcctcgatcaaattcctggcagagctacaggtgcatacagccacagtcagggc
gtcaaaggattacgtgatacaattgcatctggtattgaagctcgcgatggcttccctgct
gatccaaatgatattttcttgactgatggtgcaagcccagcggttcacatgatgatgcag
ttgctcattgggtcagagaatgatggaattctctgtcctatccctcaatatccactttat
tccgcttcaattgccctccatggtggcactcttgttccctattatcttgatgaagaaaca
ggatggggattggagatctcagagcttgagaatcagctgaaaactgcaaaatccaagggt
attaaagttagggctttggttgtgatcaatccaggcaacccaactgggcaggttcttgct
gaggccaaccaacgagatattgtgaaattctgcaagaaagaaggcctcgttcttttggcg
gatgaagtgtatcaggaaaatgtttatgtgcctgagaagcagttccactcgtttaagaaa
attgctcgctctatgggatttggagaaaaggacatctctttagtttcttttcagtctgtg
tcaaaaggattttatggagagtgtggaaagcgaggaggttacatggaggtcactggattt
agccctgagataagggaacagatatacaaagtggcatctgtcaatctgtgttccaacatt
tctggtcagattcttgcaagcctcgtcatgagccccccaaaggtgggtgatgaatcatac
gagtcttttagtgctgagaaagaagctatactctcatccttggcaaggcgtgcaaagaca
ctagaagatgcattcaacagtttggagggtgtaacatgcaataaagcagagggcgcaatg
tatctatttccacgtattaacttaccagctaaagcaataaaagcagcagaagaagctaaa
actgcaccagatgccttttatgctcgacgcctcctcaatgccactggaattgttgttgtc
cctgggtctggatttggccagcgtcctggaacgtggcattttaggtgcacaatattaccg
caagaagagaagataccagctattgtatctagtcttacagatttccataagcagttcatg
gatgaattccgcggctaa

DBGET integrated database retrieval system