KEGG   Nicotiana tomentosiformis: 104102743Help
Entry
104102743         CDS       T05025                                 

Definition
(RefSeq) ribulose bisphosphate carboxylase small chain clone 512-like
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
nto  Nicotiana tomentosiformis
Pathway
nto00630  Glyoxylate and dicarboxylate metabolism
nto00710  Carbon fixation in photosynthetic organisms
nto01100  Metabolic pathways
nto01200  Carbon metabolism
Module
nto_M00165  Reductive pentose phosphate cycle (Calvin cycle)
nto_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
nto_M00532  Photorespiration
nto_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:nto00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    104102743
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    104102743
Enzymes [BR:nto01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     104102743
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RuBisCO_small
Motif
Other DBs
NCBI-GeneID: 104102743
NCBI-ProteinID: XP_009608851
LinkDB All DBs
Position
Unknown
AA seq 169 aa AA seqDB search
MSVSSFVAAPIAGSTYLGLKSNNTNLFPAKDTITWNRKTISNGSKTYCMKTWNPIDNKKF
ETLSYLPPLSEDSIAKEVDYMIQKGWIPCLEFDQVGYVRRENSSMPGYYDGRYWTLWKLP
MFGCNDSSQVLNEIQDCKKAYPNAFIRCLAFDNVKQVQCMAFLIQKPVA
NT seq 510 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtctcaagttttgttgcagctccaattgctggatcaacctatcttggattgaaa
tccaacaacaccaacctttttcctgctaaggatacaatcacttggaatcgaaaaactatc
tccaatggctctaaaacttactgcatgaagacttggaatccgatcgacaacaagaaattc
gagacactctcatatctgccacctctatcagaagattcgattgcaaaggaggttgattac
atgatccaaaagggctggattccttgccttgaatttgatcaggtgggatatgtacgcagg
gaaaatagcagcatgccaggctactatgatggaaggtattggacactgtggaagcttccc
atgtttggctgcaatgactcatcccaagttctgaatgaaatccaagattgcaagaaagcc
tacccaaatgctttcattcgttgtttggcatttgacaatgttaaacaggttcagtgcatg
gcctttctcattcagaaacctgtagcatag

DBGET integrated database retrieval system