KEGG   Nicotiana tomentosiformis: 104109358Help
Entry
104109358         CDS       T05025                                 

Definition
(RefSeq) sorbitol dehydrogenase
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
nto  Nicotiana tomentosiformis
Pathway
nto00040  Pentose and glucuronate interconversions
nto00051  Fructose and mannose metabolism
nto01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nto00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    104109358
   00051 Fructose and mannose metabolism
    104109358
Enzymes [BR:nto01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     104109358
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 Pyr_redox_2 Sacchrp_dh_NADP AlaDh_PNT_C Methyltransf_25 UDPG_MGDP_dh_N
Motif
Other DBs
NCBI-GeneID: 104109358
NCBI-ProteinID: XP_009616918
LinkDB All DBs
Position
Unknown
AA seq 359 aa AA seqDB search
MGKGGKSNEGEENMAAWLLGVNTLKIQPFNLPPLGSHDVRVRMKAVGICGSDVHYLKTLR
CADFVVKEPMVIGHECAGIIDEVGSEVKTLVRGDRVALEPGISCWRCDLCKEGRYNLCPE
MKFFATPPVHGSLANQVVHPADLCFKLPDNVSLEEGAMCEPLSVGVHACRRANVGPETNI
LVLGAGPIGLVTLLAARAFGAPRIVIVDVDDYRLSVAKKLGADDIVKVSTNIQDVAADID
NIQKAMGAGIDVSFDCAGFNKTMSTALGATCPGGKVCLVGMGHHEMTVPLTPAAAREVDV
IGIFRYKNTWPLCLEFLRSGKIDVKPLITHRFGFSQKEVEEAFETSAAGGDAIKVMFNL
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgggtaaaggaggaaaaagtaatgagggtgaagaaaacatggctgcttggcttcttggt
gttaacaccctcaagattcagcctttcaatctccctcctttgggatcccatgatgttaga
gttaggatgaaagctgttggtatttgtggaagtgatgttcactacctcaagaccttgaga
tgtgctgattttgtagttaaagaaccaatggtgattgggcacgaatgtgctgggatcata
gacgaagttggtagtgaagtcaagacattggttcgtggtgatcgtgtggcactagagccc
ggaattagttgctggagatgtgatctttgcaaggaaggccgatataatctctgccccgag
atgaaattcttcgctactcctcctgttcatggttctctcgcaaatcaggtagtccatcct
gcagatctatgtttcaagctccccgataatgtaagtttggaggaaggagcaatgtgtgag
ccacttagtgttggtgttcatgcttgtcggcgtgcaaatgttggtcctgagacaaacata
ttagtactgggagctggaccaattgggcttgtcacactgctcgcagctcgtgcttttggt
gccccaagaattgttattgttgacgtggatgactatcgtctttctgttgcaaagaagtta
ggagcagatgacatagtcaaggtctcaactaatattcaggatgtagctgcagatatagat
aacattcagaaagctatgggagctggaatcgacgtgagttttgattgtgctggctttaac
aaaaccatgtctaccgctcttggtgcaacttgtccaggcggcaaagtttgcttagtagga
atgggacatcatgagatgactgttcctctcactccagctgctgcgagggaggttgatgtc
ataggcatattccgctacaagaatacgtggcctctgtgtcttgagttcttaagaagtggg
aagatcgacgtgaaacctttgatcacacacaggtttggattctctcaaaaggaagttgaa
gaagcttttgaaacaagtgctgctggtggtgatgctattaaagtcatgtttaatctgtaa

DBGET integrated database retrieval system