KEGG   Nicotiana tomentosiformis: 104109477Help
Entry
104109477         CDS       T05025                                 

Definition
(RefSeq) histone-lysine N-methyltransferase ASHH3-like
  KO
K11423  histone-lysine N-methyltransferase SETD2 [EC:2.1.1.43]
Organism
nto  Nicotiana tomentosiformis
Pathway
nto00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:nto00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    104109477
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:nto03036]
    104109477
Enzymes [BR:nto01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     104109477
Chromosome and associated proteins [BR:nto03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     104109477
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET
Motif
Other DBs
NCBI-GeneID: 104109477
NCBI-ProteinID: XP_009617091
LinkDB All DBs
Position
Unknown
AA seq 375 aa AA seqDB search
MIEPMPAMKKSAVHGGIGHVFNKLTSEIGDPVDFELPDWLNKWQPTPFTYIKRNIYLTKK
VKRRLEDDGIFCSCSSTAGSSDVCGRDCLCGILWSSCSSGCKCGSACLNKPFHQRPVKKM
KIVMTEKCGSGIEAGEDIKRKEFVIEYVGEVIDDKTCEERLWKMKHSGETNFYLCEINRD
MVIDATYKGNKSRYINHSCCPNTEMQKWLMDGETRIGIFATRDIKKGEHLTYDYQFVQFG
ADQDCHCGAVKCRRKLGIKPNKRKLSSSDAALKLVACQVAASSPKVKALLSVKHGCQTGV
PPKGSWNCDSAQRIQRPRNCVGHLIRIIRSCDQRSFGIIKQFDSITKKHLIMFEDGSVEY
VDMSTEDWEFCNFLV
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgattgaacccatgcctgctatgaagaagagtgctgtccatggtgggattgggcatgta
ttcaacaaattgacaagtgaaattggagatcctgttgactttgaacttccagattggttg
aataaatggcaacccacaccctttacctatataaagcgtaatatatacctcaccaagaag
gttaagcggcggctggaagatgatggcatattttgttcctgcagttcaacagcaggatct
tcggacgtgtgtggcagggattgtctgtgtggcattttgtggtctagctgctcctcaggg
tgtaaatgtgggagtgcttgtctgaacaaaccattccatcaacgtcctgtgaagaagatg
aaaatagttatgactgagaaatgtggcagtgggattgaggcaggtgaagatatcaagaga
aaagagtttgttatagaatatgttggagaagttattgatgacaaaacatgtgaagagaga
ctttggaaaatgaagcacagtggggaaacaaatttttacttgtgtgagatcaatcgggat
atggtgattgatgccacttacaagggcaacaaatccagatacattaatcatagctgttgt
ccaaatactgagatgcagaaatggttgatggatggtgagacaagaattggcatatttgcg
acacgtgacattaaaaagggcgagcatctgacctacgattatcagtttgttcaatttggc
gcagatcaagattgccactgtggtgctgtaaaatgtaggcgaaagctgggaattaaacct
aacaaacgaaaactttcctcttcagatgctgcattaaagttagtggcatgtcaagttgct
gcgtcctctcccaaagtgaaagcattgctatctgtaaaacatggttgtcaaactggagtt
cctccaaaaggaagttggaattgtgattctgctcagagaatccagcgtcctcgtaactgc
gtaggtcatcttataagaataattcgctcttgtgatcaaaggtcctttggaattataaaa
cagtttgacagcatcaccaaaaaacatttgatcatgtttgaagacggtagtgtcgaatac
gttgacatgtcaacagaagattgggaattttgtaactttcttgtgtaa

DBGET integrated database retrieval system