KEGG   Nicotiana tomentosiformis: 104109643Help
Entry
104109643         CDS       T05025                                 

Definition
(RefSeq) aldehyde dehydrogenase family 2 member B4, mitochondrial-like isoform X1
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
nto  Nicotiana tomentosiformis
Pathway
nto00010  Glycolysis / Gluconeogenesis
nto00053  Ascorbate and aldarate metabolism
nto00071  Fatty acid degradation
nto00280  Valine, leucine and isoleucine degradation
nto00310  Lysine degradation
nto00330  Arginine and proline metabolism
nto00340  Histidine metabolism
nto00380  Tryptophan metabolism
nto00410  beta-Alanine metabolism
nto00561  Glycerolipid metabolism
nto00620  Pyruvate metabolism
nto00903  Limonene and pinene degradation
nto01100  Metabolic pathways
nto01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nto00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    104109643
   00053 Ascorbate and aldarate metabolism
    104109643
   00620 Pyruvate metabolism
    104109643
  09103 Lipid metabolism
   00071 Fatty acid degradation
    104109643
   00561 Glycerolipid metabolism
    104109643
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    104109643
   00310 Lysine degradation
    104109643
   00330 Arginine and proline metabolism
    104109643
   00340 Histidine metabolism
    104109643
   00380 Tryptophan metabolism
    104109643
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    104109643
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    104109643
Enzymes [BR:nto01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     104109643
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 104109643
NCBI-ProteinID: XP_009617290
LinkDB All DBs
Position
Unknown
AA seq 536 aa AA seqDB search
MATRRLSSLLSRSLHFPSASAPLAGRSNGVARHINRFSTAAAVEEVTTPPVQVSFTKLLI
NGQFVDSASGKTFPTLDPRTEEVIANVAEGDAEDINRAVAAARKAFDEGPWPKMSAYERS
KIMFKFADLVEKHNDELAALETWDNGKPYLQAAQAEVPSFVRLFRYYAGWADKIHGLTVP
ADGPHHVQTLHEPIGVAGQIIPWNFPLLMFAWKVGPALACGNTIVLKTAEQTPLTALYVA
NLFHEAGLPPGVLNIVSGFGPTAGAALASHMDVDKLAFTGSTETGKTVLELAAKSNLKPV
TLELGGKSPFIICEDADIDHAVELAHFALFFNQGQCCCAGSRTYVHERVYDEFIEKAKTR
AMRRVVGDPFKKGVEQGPQIDSEQFQKILRYIRSGRDSSATLECGGDRFGSKGYFIQPTV
FSNVKEDMLIAQDEIFGPVQCVFKFKDIGEVIKRANNTRYGLAAGVFTKNIDTANTLTRG
LRAGTVWVNCYDVFDAGIPFGGYKMSGMGREKGIYSLSNYLQVKAVVTPLKNPAWI
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
atggcaactcgaagactttcttctttgctctctcgttctctccattttccttctgcttct
gctcctctagcaggaaggagcaatggtgtggcaaggcacatcaacaggtttagtactgct
gctgcagttgaagaagtaaccactccacctgttcaagttagtttcactaagcttctaatc
aatggccaattcgttgattctgcatctggaaaaacattcccaactttggatccaagaact
gaggaagtcattgcaaatgttgctgaaggtgatgctgaagatattaatcgcgctgtggct
gctgctcgcaaggcatttgatgagggaccttggcccaaaatgagtgcttatgaaaggtca
aagataatgtttaagtttgctgatttggtggagaaacacaatgatgagcttgcagcttta
gaaacatgggataatggcaaaccatatttgcaggctgcacaagctgaagtaccttctttt
gtgcgattatttcgatattatgctggttgggcagataaaatccatggtctaaccgttcca
gctgatgggccacaccatgtgcaaactttacatgaaccgattggtgttgctggtcaaata
attccatggaactttccccttcttatgtttgcctggaaagttgggcctgccctagcttgc
ggtaacactattgtcctgaagactgcagagcaaactccactgactgctctttatgttgca
aacttattccacgaggctggtcttcctccaggtgttctaaatattgtttctggttttgga
ccaactgctggtgcagcacttgctagtcatatggatgtggacaagcttgctttcactgga
tcaacagaaactggaaaaacagtacttgaactggctgccaaaagcaatctgaaaccagtt
accctcgaactaggagggaaatcacctttcattatatgcgaggatgctgacattgatcat
gccgttgagctagcacattttgcactcttctttaatcagggccaatgttgctgtgctggt
tctcgtacctatgtacatgagcgagtatatgatgaattcatagagaaggcaaagacacgt
gcaatgagacgtgtagttggcgatcccttcaagaaaggtgttgagcaaggtcctcagatc
gactcggagcaattccagaagattcttcggtacataagatcaggccgtgacagctctgct
acccttgaatgtggtggtgatagatttggctccaaaggctactttattcagcccactgta
ttctcaaatgtgaaggaggacatgttgatagcacaggatgagatttttggcccagtgcag
tgtgtcttcaaattcaaggatattggcgaagtgataaagagagcaaacaacacgcgctat
ggtctagcagcaggagtattcacaaagaacatcgacacagcaaacaccttgaccagagga
ctaagagctggaactgtgtgggttaactgctatgatgtatttgatgctgggattcctttt
ggagggtacaagatgagtggcatgggcagggaaaagggaatttacagccttagcaactac
ttacaggtgaaagctgttgttactccattgaagaatcctgcgtggatatag

DBGET integrated database retrieval system