KEGG   Nicotiana tomentosiformis: 104111562Help
Entry
104111562         CDS       T05025                                 

Definition
(RefSeq) alpha-glucosidase
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
nto  Nicotiana tomentosiformis
Pathway
nto00052  Galactose metabolism
nto00500  Starch and sucrose metabolism
nto01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nto00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    104111562
   00500 Starch and sucrose metabolism
    104111562
Enzymes [BR:nto01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     104111562
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2
Motif
Other DBs
NCBI-GeneID: 104111562
NCBI-ProteinID: XP_009619581
LinkDB All DBs
Position
Unknown
AA seq 899 aa AA seqDB search
MNKTKQTQTQFVLYNCLLLFFILLVLTKAEPVGYGYTVRSVGVDSSGKTLTAHLQLIKSS
SVFGPDIQNLTLTACFETKDRLRVRITDADHERWEVPQEFIPRETHSFPRSSLLEKHSYF
SLPLSEDTHYFHTDTISDLIFTLYNTTPFGFTIKRRSSGDILFDTSPKSNSPDTFLIFKD
QYLQLSSSLPANRSSIYGLGEHTKRTFKLKHNQTLTLWDADIASANVDLNLYGSHPFYMD
VRSNPGAGSTHGVLLFNSNGMDIVYAGDRITYKVIGGVIDLYFFAGPVPEKVMEQYTELI
GRPAPMPYWSFGFHQCRYGYKSITEVENVVARYAKSQIPLEVMWTDIDYMDGYKDFTVDP
INFPLDRMKKFVDKLHQDGQKFVLILDPGISINSSYETYKRGMEADVFIKRDDVPYLGEV
WPGKVYFPDFINPKARVFWSTEIKIFHESLPVDGLWLDMNELSNFISSPPSPSSTLDNPP
YKINNSGSLRPINEKTVPATSVHYGNTLEYNVHNLYGFLESKTTNAALVDITGKRPFILS
RSTFVGAGKYTAHWTGDNAATWDDLAYSIPSILNSGLFGIPMVGADICGFGKNTTEELCR
RWIQLGAFYPFSRDHSEKFSIHQELYIWDSVAATARKVLGLRYRLLPYFYTLMFEAHSRG
VPIARPIFFSFPEDANTYDIDSQFLIGKGLMISPVLISGAVSVNAYFPSGTWFNLFNYSN
YVNMKSGNYINLAAPSDHINVHLREGNILAMQGEAMTTRAARDTPFELLVAISDKGNSSG
EVYLDDGEEVEMGGKGGKWSLVRFHSGIVNSKLYLKSEVVNEEFAMSKNWTIHKVTFLGL
KKRVTRISANKLTSKMVGKRHIYSRTRTNFDRSTSGVLEMSGLSVLIGKEFSLELTLAK
NT seq 2700 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaacaaaacaaactcagacacaatttgttctgtataattgtctgttgttgttc
ttcattttgttggtattaacaaaagctgaaccagttggatatggatatactgtccgatca
gtaggcgttgactcctctggaaagacattgactgctcatcttcaactcatcaaaagttct
tctgtttttggacctgacattcaaaatctcacacttactgcctgctttgagacaaaagat
cgtttaagagtcaggattacggatgcagatcatgaaagatgggaagttccacaagaattt
atcccccgcgaaactcattctttcccccgcagctcccttttggagaaacattcttatttc
tcacttccattatcagaggacacacattatttccatacagataccatttcagaccttatt
ttcactctctacaacaccaccccttttggctttactatcaaacgtcgctcctcaggtgac
attctttttgacacctcgcctaaaagtaactctccggacacgttccttatcttcaaggac
cagtaccttcaactgtcctcttcattgcccgccaataggtcatctatatatggcctcggt
gagcataccaagagaacgtttaagctcaaacataatcagacattaactctttgggatgct
gatattgctagtgccaatgttgatctcaacttgtatggctcccatcctttttacatggac
gtcaggtctaatcctggcgcagggagtactcacggagtcttgttattcaatagcaatggg
atggatatcgtatatgctggtgatcgaattacctacaaagtgattggaggggtcattgac
ctgtatttctttgctggtcctgtgccggagaaggtcatggagcagtacacggagctcatt
ggccgccctgcacccatgccttactggtcttttggctttcaccaatgccgatatggctat
aaaagtattactgaagttgagaatgtggtagcgcgctatgcaaaatctcagatccctctt
gaggtcatgtggacagatattgattatatggacggctataaggatttcacagttgatccg
attaatttcccacttgaccggatgaagaaatttgttgataaacttcatcaagatggccag
aaatttgttctcatattggatccagggatcagtataaatagctcgtatgagacttataag
agaggtatggaagcagatgttttcatcaaacgcgatgatgtcccttatcttggcgaagtt
tggcctggaaaagtctactttcctgatttcataaatcccaaagccagagtcttctggagt
actgaaatcaaaattttccatgaaagtctccccgttgacgggctctggcttgatatgaac
gagttatctaacttcatttcttctcctccaagcccatcttctactcttgacaatcctcct
tataagatcaataactcgggaagcttacgtccaatcaacgagaagactgtcccagcaaca
tcagtacattatgggaacaccttagagtacaatgttcataacctctatggattcctcgaa
tctaaaacgaccaatgctgctttagtcgacattactggtaaaaggccatttatacttagc
agatctacatttgtgggtgctggaaagtacacagcgcattggactggagataatgctgca
acttgggatgacttggcttatagtattcctagcattttaaattctggattgtttggaatt
cccatggttggagctgatatatgtggctttggtaaaaatacaactgaggaactttgccgc
cgttggattcagctaggtgcattttatcccttttcaagggatcactctgaaaagtttagt
atccatcaagagttatatatctgggattcagtagctgcaacagctagaaaggttcttgga
cttcgctatcggctcttaccatacttctacacgctaatgtttgaggcgcattctagaggc
gttcctatagcacggccaattttcttttcatttcctgaggatgcaaacacttatgatatt
gactctcagtttctcattggtaaggggttaatgatatcgccagtgctaatatctggagcg
gtttcagttaatgcatattttccgtctggaacctggttcaacctctttaactattcaaac
tacgtgaatatgaagtccggtaactacatcaaccttgctgcaccttctgatcatatcaac
gtacaccttcgagaaggaaatattctggcaatgcaaggagaagcaatgacaacaagggca
gctcgggacactccattcgaacttcttgttgccatcagcgacaagggaaatagttcaggc
gaagtttacttggacgatggagaagaagttgaaatgggaggaaagggtggaaagtggagc
ttagtgagatttcacagtggtattgtaaacagtaagttatatctcaaatcagaggttgtg
aatgaagagtttgctatgagtaagaattggacaatacacaaagtgacttttcttggactg
aagaaaagggtgactagaataagtgcaaataagttgacctctaaaatggtaggcaagaga
catatatactcaagaactagaacaaactttgacagaagtacatctggtgttttagagatg
tcaggtctatcagttctgattggcaaagaatttagtcttgagctaacacttgccaaataa

DBGET integrated database retrieval system