KEGG   Nicotiana tomentosiformis: 104114026Help
Entry
104114026         CDS       T05025                                 

Definition
(RefSeq) hexokinase-2
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
nto  Nicotiana tomentosiformis
Pathway
nto00010  Glycolysis / Gluconeogenesis
nto00051  Fructose and mannose metabolism
nto00052  Galactose metabolism
nto00500  Starch and sucrose metabolism
nto00520  Amino sugar and nucleotide sugar metabolism
nto01100  Metabolic pathways
nto01110  Biosynthesis of secondary metabolites
nto01200  Carbon metabolism
Module
nto_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
nto_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:nto00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    104114026
   00051 Fructose and mannose metabolism
    104114026
   00052 Galactose metabolism
    104114026
   00500 Starch and sucrose metabolism
    104114026
   00520 Amino sugar and nucleotide sugar metabolism
    104114026
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    104114026
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:nto04131]
    104114026
Enzymes [BR:nto01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     104114026
Membrane trafficking [BR:nto04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    104114026
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 104114026
NCBI-ProteinID: XP_009622660
LinkDB All DBs
Position
Unknown
AA seq 497 aa AA seqDB search
MKKATVGAVVVGAAATVAVAALIVRHRMRKSSKWARAMAILKEFEEKCRTPDAKLKQVAD
AMTVEMHAGLASEGGSKLKMLISYVDNLPTGDEEGVFYALDLGGTNFRVLRVQLGGKDGG
IVHQEFAEASIPPNLMVGTSEALFDYIAAELAKFVAEEEERFHQPPGKQRELGFTFSFPI
MQTSINSGTLIRWTKGFSIDDTVGQDVVAELTKAMQRKGIDMRVSALVNDTVGTLAGGRF
SNKDVCIAVILGTGTNAAYVERAQAIPKWHGPLPKSGEMVINMEWGNFRSSHLPLTEYDH
AMDTDSLNPGEQIFEKICSGMYLGEILRRVLLRMAEEAGIFGDEVPPKLKNQFILRTPEM
SAMHHDTSSDLRVVGDKLKDILEISNTSLKTRRLVVELCNIVATRGARLAAAGVLGIVKK
MGRDTPRESGQEKIVVAMDGGLYEHYTEYRKCLENTLVELLGEEMATSIVFEHANDGSGI
GAALLAASNSLYVEDKS
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaggcgacggtgggagcggtggtggtgggggcggcagcgacggtagctgtggcg
gcactcatcgttcggcaccgaatgcggaaatcgagcaagtgggcacgtgcgatggcaatc
ctgaaggaattcgaggagaagtgtaggaccccagatgccaagctgaagcaggtggctgac
gccatgacggtggagatgcacgccggcctcgcctctgagggcggcagcaaactcaagatg
cttatcagctacgtcgacaatctccccactggcgatgaagaaggagtcttttatgcattg
gatcttggtggaacaaattttcgagtattgcgggtgcaattggggggaaaagatggtggt
attgtccatcaagaatttgcggaggcatcaattcctccaaatttgatggttgggacttca
gaagcactttttgactatattgcggcagaacttgcaaaatttgttgctgaagaagaagaa
agatttcatcaacctcctggtaagcagagggaactcggtttcactttctcattcccaatc
atgcagacttcaatcaattctggaactcttatcaggtggacgaaaggtttctccattgat
gacacggttggacaagatgttgttgcagaactgacaaaagccatgcaaagaaaaggaatt
gatatgagagtgtcggcgctggtgaatgatactgttggaacattggctggtggtagattc
tccaataaggatgtatgcattgctgtgatattaggtactgggaccaatgcagcatatgtg
gaacgggctcaggcaattcccaagtggcatggtcctctgcctaaatctggagaaatggtt
atcaatatggaatggggtaactttaggtcctcccatcttcctttgacagagtacgatcat
gcaatggatacagatagtttaaatcctggtgaacagatatttgagaagatatgctctggc
atgtacttgggagaaattttacgcagagttctactcagaatggctgaagaagctggcatt
ttcggtgatgaggtccccccaaaactcaagaatcaattcatattgaggacacctgaaatg
tctgctatgcatcatgacacatcctctgatttgagagtggttggcgacaagttgaaggat
atcttagagatatccaatacctccttgaagacaagaagattagttgttgagctgtgcaac
attgttgcaacacgtggtgcaaggcttgcagcggctggggtcttaggcattgtcaaaaag
atgggcagggatacgcccagggaaagtggtcaagaaaagatagtcgtagccatggatggt
ggattgtatgagcactatacagaatacagaaagtgcttggagaacactttagttgaattg
cttggagaggaaatggcaacaagtattgtttttgagcacgcgaatgatggttctggcatt
ggcgctgcacttcttgcggcctctaactccctatatgttgaagacaagtcttga

DBGET integrated database retrieval system