KEGG   Nicotiana tomentosiformis: 104115838Help
Entry
104115838         CDS       T05025                                 

Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit 1, mitochondrial
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
nto  Nicotiana tomentosiformis
Pathway
nto00020  Citrate cycle (TCA cycle)
nto00190  Oxidative phosphorylation
nto01100  Metabolic pathways
nto01110  Biosynthesis of secondary metabolites
nto01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:nto00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    104115838
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    104115838
Enzymes [BR:nto01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     104115838
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 GIDA DAO FAD_binding_3 HI0933_like
Motif
Other DBs
NCBI-GeneID: 104115838
NCBI-ProteinID: XP_009624858
LinkDB All DBs
Position
Unknown
AA seq 629 aa AA seqDB search
MWRCVSRGLRASSNRSISGGGHFRRLFSSQTNVGGSSYTVVDHTYDAVVVGAGGAGLRAA
IGLSEHGFNTACLTKLFPTRSHTVAAQGGINAALGNMSEDNWRWHMYDTVKGSDWLGDQD
AIQYMCREAPKAVIELENYGLPFSRTEDGKIYQRAFGGQSLDFGKGGQAYRCACAADRTG
HALLHTLYGQAMKHNTQFFVEYFALDLLMNSDGSCQGVIALNMEDGTLHRFRATSTILAT
GGYGRAYFSATSAHTCTGDGNAMVARAGLPLEDLEFVQFHPTGIYGAGCLITEGSRGEGG
ILRNSEGERFMERYAPTAKDLASRDVVSRSMTMEIREGRGVGPLKDHIYLHLNHLPPEVL
KERLPGISETAAIFAGVDVTKEPIPVLPTVHYNMGGIPTNYHGEVVTIKGDNPDSVVPGL
MAAGEAACASVHGANRLGANSLLDIVVFGRACANRVAEIQRPGENQKPLEKDAGERTIAW
LDKIRNSNGSLPTSKIRLNMQRVMQNNAAVFRTQDTLEEGCQLIDKTWESFHDVQLKDRS
LIWNSDLIETIELENLLINACITMHSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWEN
EKVRLEYRPVHMNTLDDEVESFPPKARVY
NT seq 1890 nt NT seq  +upstreamnt  +downstreamnt
atgtggcggtgtgtgtcgcgtggccttcgcgcttcctccaacagatctatctccggcggc
ggccattttcgccgacttttctcctcacagactaatgtgggaggctcgtcatatacggtg
gtggatcacacatacgatgcagtggtggtaggtgcaggcggtgcagggcttcgagcggca
atagggttgtctgagcatggattcaatactgcttgcttaaccaagctctttcctactcga
tctcacaccgttgcagctcagggcggtataaatgcagcattaggcaatatgtcagaggac
aattggaggtggcacatgtatgatacagttaaaggaagtgattggttaggtgatcaggat
gctatccaatatatgtgtagagaagcgccaaaagcagttatagagcttgagaattatggt
ttgcctttctctcgaactgaagatggtaaaatatatcaacgtgcatttggtggtcaaagc
ctagactttggaaaagggggacaagcatatcgttgtgcttgtgctgctgatcggactggg
catgctctactgcatactctttatgggcaggccatgaagcataatacacagtttttcgtg
gaatattttgctttggatttactaatgaacagtgatgggagctgccaaggtgtaatagca
ctaaatatggaggatggtaccttgcatcggttccgtgccacctctactattttggccaca
gggggttatggtcgggcttacttctctgcaacatctgctcatacttgcaccggagatggt
aatgctatggtcgcgcgtgctgggcttcctcttgaggatcttgagtttgtgcagtttcat
ccaactggtatatatggagctggttgtctcattactgaaggatctcgtggtgaaggtggt
attctgaggaatagtgagggtgagcgatttatggaaaggtatgccccaacagccaaggat
cttgcgtcaagagatgttgtttccagatctatgacaatggaaattcgagaagggcgtggt
gtaggaccattgaaggatcatatctatcttcatctcaatcacttacctccggaggtcctt
aaggagagacttcctggtatctctgaaacagctgccatttttgctggtgttgatgtaact
aaggagccaattcctgttttacctaccgtgcattataatatgggaggaatccccacaaat
taccacggagaggtggtcactattaaaggagataatcctgattccgtggtccctggactg
atggctgctggtgaagcagcatgtgcatcagttcatggtgccaatcgtcttggtgcaaat
tctcttctagacattgttgtttttgggcgggcatgtgctaatagggttgctgaaatccaa
agaccaggggagaaccagaagccacttgagaaggatgcaggagagaggaccattgcatgg
ttggacaagattaggaactcaaatggttcactgcctacctcaaagattcggctgaacatg
caaagagttatgcaaaacaatgctgctgtcttccgcacacaagatacactagaggaaggt
tgccagctcattgacaaaacatgggagagtttccatgatgttcagttgaaggatagaagt
ttaatatggaactcagatcttatagagactattgagctggaaaaccttttgatcaatgca
tgcatcaccatgcactcagctgaggctagaaaggaaagcagaggagctcatgctcgtgaa
gattttacgaaaagagatgatgagaagtggatgaaacatacactaggatattgggagaac
gagaaggtccggctagagtacagaccagttcatatgaacactctagatgacgaggttgag
tcattcccacccaaggcacgtgtctattga

DBGET integrated database retrieval system