KEGG   Nicotiana tomentosiformis: 104116622Help
Entry
104116622         CDS       T05025                                 

Definition
(RefSeq) DNA polymerase zeta catalytic subunit isoform X3
  KO
K02350  DNA polymerase zeta [EC:2.7.7.7]
Organism
nto  Nicotiana tomentosiformis
Brite
KEGG Orthology (KO) [BR:nto00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:nto03400]
    104116622
Enzymes [BR:nto01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     104116622
DNA repair and recombination proteins [BR:nto03400]
 Eukaryotic Type
  TLS (translesion DNA synthesis) factors
   B-family DNA polymerases
    104116622
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_pol_B DNA_pol_B_exo1 zf-C4pol C1_2
Motif
Other DBs
NCBI-GeneID: 104116622
NCBI-ProteinID: XP_009625809
LinkDB All DBs
Position
Unknown
AA seq 2012 aa AA seqDB search
MGDSQTDSNFFSVRIVSIDYYMAAPIPGFDICYSSFQGGRVNEVPVIRVYGATPAGQKTC
LHLHGALPYFYVPWSDLFLQSDQKDRLGSECTNALALALEKVLKLKGNAGSKRQHVHGCS
LVRARKFYGYHSSEELFVKIYLYHPQDVSRAANLLLGGAVMDKSLQPHESHIPFLLQFLV
DYSLYGMGHLHVSKMKFRNPIPDTFAPRKAKCFDRRRHSDMSTSMTAEFQVDLGGEACFN
TPIWVSSTITDDWIWTGSSQADLSTNPDIPNIKRQSISDLEGDAIVDAILNQQFISCMSL
SQTSSQEKMVQSIIPIWEEEFARNGVHEVGLPPDPGKPLRDDVLRTLSHGLGYEEILMEL
SNDVNTSSSDIPQSINSSMNDGSVAKHVHCGSLNSIREPSRCSEEGLFQDHVVVESREET
DACPKQMLADKLKAAVSVVPSQDLKASDQDALRLLNWLASSQASEDINSDDDLAREIILS
PLMPAATINTVLEKANVAYENESQQECEDILDSVHGCHFEELDRKTSESISSDHSCRSSP
GVMIPQLDGSNDDPSPHRKLGTSSQADLLNNASLAISNKHKKKKPGWCSLPISLGQNVND
CSHPNPANTSSNHICGERDDRGTSSHMSFNKYPNFLTGSLNASANCEMEASMIVECSTRD
LMRVKRSYHAESPEYENQVKKVQFGAKGKEDSFLYAESRHDEKEKMPLDSLISRSAITDQ
PKECHERNSCLALQMQADPGDIKADKSNCPSYGKLPLSSCSLLANALKDGVFLSSEGPHV
EVVRRTSASLQNYGTSDASTSQGTKELFQLPDVENQKTAIYMGSCGCSSRENVDSCVKCT
KTSNSDLCTSVFAPYSQFASETEGKFTGFGKLLQKNAVGLSQSPVGPNSPTSAVTGVSGD
SVELIGMTFIKKPPKVEFTDEPGRNAQLACGAPSYHVGNRKNKTRTCAQDRGLDECSPFF
EGKCLVGEKICSTSSGTRNYIHCQDNMLGVPIHYQNDGSYLYMLTPVYSPPRSECVQQWL
SLDCIESSKMNVVSGPPVYPSIKVCSDDVAESQGSQSTFGDQPLMDSVSASEPNPNYLQA
KENYQESNSVQMNSVSPHARIKQQNENIILKCEPSMRGSQDLSQISGPDGKSRLTPLSQT
GFRDPASIGCGQQLTILSIEVQAESRGDLRPDPRVDAVRIVVLVFQEDDDLRSDTHVLVH
CNGESVQKDLDGLSECKVFTFSEERQVFVHFIKMINSFDPDILMGWDIQGGSLGFLAERA
AYLGIGLLNNISRTPSEGNIVSRDSEGGKLSDVFSEAVATDPMFHEDAAIIDDEWGRTHA
SGVHVGGRIVLNIWRLMRGEVKLNLYTLEAVAEAVLRRKVPYIPTKVLTNWFLSGPGRAR
YRCIEYVLERAKLNLHIMNQLDVVNRTSELARIFGIDFFSVLSRGSQYRVESMFLRLAHA
QNYVAVAPGNQQVASQPAMECIPLVLEPKSGFYADPVVVLDFQSLYPSMIIAYNLCFCTC
LGKVTSAKTNILGVSSYSPDKNVMHNLKDEILLTPNGVMYVPPKVRKGVLPRLLEEILDT
RIMVKTAMKKLAPGQQVLHRIFNARQLALKLIANVTYGYTAAGFSGRMPCAELADSIVQC
ARRTLESAISFVNTNDRWNAKVIYGDTDSMFVLLEGRSVEEAFRIGHEIASEVTAMNPNP
VTLKMEKVYDSCFLLTKKRYVGYSYENLGQSKPVFDAKGIETVRRDTCGAVSKIMERSIR
VFFEYKDIEKVKHYLVRQWKKIISGRVSLQDFVFAKEVRLGTYSAQASSLPPAAIVATKA
MRVDPRAEPRYAERVPYVVVHGEPGARLADVVVDPLDLLSIDSPYRLNDIYYIKKQIIPA
LQRVFGLVRADLNQWFSDMPRPEREAAGKRHPFAANAHRTRIDYYYMSKHCILCGELIQA
SSYVCQNCSRNEAVVAAALTGRTSILERNIQHLATICRHCGGGDWLVESGVKCISLACSV
FFERRKIQKELRSLSAVTTDAGFYPSCVVEWF
NT seq 6039 nt NT seq  +upstreamnt  +downstreamnt
atgggggattctcagaccgattcgaacttcttcagtgttcgaattgtttcaatagactat
tacatggccgctccaattcctggcttcgacatttgttacagcagtttccaaggtgggaga
gtaaatgaggttcctgtgatcagagtgtatggtgccactcctgctggccagaagacctgt
ttgcaccttcatggggctctgccttatttttatgttccatggtcagatctcttcctccaa
tcagatcaaaaagatcggctagggagtgaatgcacgaatgctctagctcttgctcttgag
aaggtgctcaagcttaaaggcaatgctggctcaaaacgtcaacatgtccacggttgcagc
cttgtacgagcaaggaagttttatggttatcattcttctgaggaactgtttgtgaagatc
tatctctatcatccacaggatgtctcgcgcgctgccaatctacttctgggaggtgcagta
atggataagtcattacagccccacgaatctcatatacctttccttcttcaattcctggtt
gactatagcttgtatgggatgggtcatctacatgtatcaaagatgaagttccgcaatcca
ataccagatactttcgctccaagaaaggctaaatgctttgatagaagaaggcattctgat
atgtccacttccatgactgcagagtttcaggttgatttaggtggtgaggcttgtttcaac
acaccaatttgggtatcttctacaattacggacgattggatatggacaggctctagtcag
gctgacctttcaacaaatccggatatccctaacattaagcgacaaagtatctctgacctt
gaaggagatgctattgttgatgcaattctgaatcagcagtttatatcctgtatgtccctt
tcacagaccagctcccaagagaaaatggttcagtcaataataccaatttgggaggaggag
tttgcaaggaatggggtgcacgaagtgggtttgcctcctgatcctggtaaaccccttcga
gatgatgtcttgagaacactttctcatgggcttggatatgaagagattctaatggaatta
agcaatgatgtgaacacttcttcttctgatattccacagtcaatcaactcatcaatgaat
gatgggagcgttgccaaacatgtacattgtggctctttaaatagtatacgggaaccatcc
cgatgctcagaagaaggattatttcaagatcatgttgttgttgaatcaagggaggaaact
gatgcatgtcccaagcagatgttagctgataaattgaaagcagctgtttccgtggtacca
tcacaggatttgaaggcttcagatcaggatgccttgagacttctaaattggcttgcatct
tctcaagcttcagaggacataaactccgatgatgaccttgctcgggaaatcattttgagt
cctttaatgccagcagcgactattaatacggtgttggagaaggcaaatgtggcctatgag
aatgaatctcagcaagagtgtgaggacattcttgattctgttcacggttgtcattttgaa
gaattagacagaaaaacttctgagtccatcagcagtgatcattcgtgcagaagttcgccg
ggtgtgatgattcctcagctggatggctccaatgatgatccaagcccacatagaaaactc
ggaacatcttcccaagcagatttattgaataatgctagtttagccattagcaataaacac
aaaaagaaaaaaccaggatggtgctctttacccatttctttgggtcaaaatgtgaatgat
tgttcacatccaaatccagctaacacatctagcaatcacatttgtggcgaaagagatgac
agaggaacttcttctcacatgagttttaacaaataccctaattttctaacgggcagtttg
aatgcatctgctaattgtgaaatggaagctagtatgatagttgaatgctctacgcgtgat
ttgatgagggtaaaaagatcctatcatgctgagtctcctgaatatgaaaatcaggtaaaa
aaagtacaatttggtgcaaaaggaaaagaagattcttttctttatgcagaatccagacat
gatgagaaagagaaaatgcctcttgattccttgatatctcgatcagcaatcacggatcaa
ccaaaagaatgtcatgagaggaactcatgtcttgcacttcagatgcaggctgatcctggt
gatatcaaagctgacaaatctaattgtccttcatatggtaagttgcctctttcatcctgc
tctctgctggcaaatgcattaaaagatggagtgtttctttcttctgaaggacctcatgtt
gaggttgtccgcagaacatctgcaagtttgcaaaattatggaactagtgatgcatccacc
tcacaggggacaaaagaactattccagcttcctgatgttgagaatcaaaaaactgccatt
tacatgggaagctgtggatgctctagtcgtgaaaatgttgacagctgtgtgaaatgtact
aaaacttcaaattctgatctttgtacttctgtatttgctccatattctcagttcgcatct
gaaactgaaggtaaatttactggttttgggaaattgctgcaaaaaaatgcagtaggttta
agtcaatctcctgttggtcctaatagtccaacatctgcagtaactggtgtatctggtgac
tctgtggaacttataggcatgaccttcatcaagaaacctcctaaggtggagttcacagat
gaacctggacgcaatgctcagttagcatgtggtgcccctagttaccatgtggggaacagg
aaaaataaaacaaggacatgtgcccaggatagaggtttagatgaatgctcccctttcttt
gaggggaaatgcctagtaggagaaaagatttgcagtactagttctggaacaaggaactac
attcattgtcaagacaatatgttgggtgtacccattcactatcaaaatgatgggtcttat
ttatacatgctgactcctgtttattcaccaccacgaagtgaatgtgttcaacaatggctg
tcacttgattgtatagaatcttctaaaatgaatgtagtttctggcccaccagtgtacccg
tcaataaaggtttgctctgatgatgtagcagaatcacagggttctcaatccacctttggt
gatcaacctttgatggattctgtctctgcttcagaaccaaatccaaattatcttcaagct
aaagaaaattatcaggaaagcaatagtgtacaaatgaattctgtttctccccatgcaaga
ataaaacaacaaaatgaaaatattatcttgaaatgtgaaccatcaatgcgtggctctcaa
gatctctcccagatatccggtcctgatggaaaatcaaggctaactcctttaagtcaaact
ggttttcgggaccctgctagtatcggttgtggacagcagttaacaatattgagcatagag
gtccaagcagaatccaggggtgatctgagacctgatcctcgagttgatgccgtaagaatt
gttgttctcgttttccaggaagatgatgatctaagatctgatactcacgtacttgtgcat
tgcaatggtgaatctgttcaaaaagaccttgatggattatctgagtgtaaagttttcact
ttctctgaagagaggcaagtatttgttcatttcataaagatgattaattcttttgaccca
gacatacttatgggatgggatattcaaggcggttcccttgggtttcttgctgaacgggct
gcataccttggcattggtttgcttaacaatatatctcgcactccatcagagggaaatata
gtttctagagactctgaaggaggaaaactaagtgatgttttttctgaagctgttgcaact
gacccaatgtttcatgaagatgctgcaataattgatgatgaatggggccgaactcacgcc
agtggtgtccatgttgggggtagaattgtccttaacatttggcgactgatgcgtggcgaa
gtgaagctgaacttgtacacacttgaagccgtagctgaagcagtgctgagacgaaaagtt
ccatatattcctaccaaggtattgacaaattggtttttaagtggtcctggacgtgcaaga
tacagatgtatagagtatgttttagagagggcaaagctgaaccttcatatcatgaatcaa
cttgacgtggtaaatagaacatcagagcttgcacggatttttggcatcgacttcttttca
gttctttcaaggggttcacagtaccgtgttgaatcaatgtttctgaggctggctcatgca
caaaattatgttgctgttgctcctggaaaccaacaagttgcttctcaacctgccatggaa
tgtataccccttgtcttggaaccaaaatctggattttatgcagaccctgttgtcgttttg
gattttcaatcactttatccatctatgataattgcatataacctctgcttctgtacttgc
cttggtaaagttacttctgcaaaaactaatatcctcggtgttagttcatattcacctgat
aaaaatgtgatgcataatttaaaggatgaaatactgctcactccaaatggtgttatgtat
gtgcctcccaaggtccggaagggggtattacctcgcttattggaagaaattttagatact
aggattatggttaaaacagcaatgaagaaattggctcctggacagcaagttcttcatcgg
atattcaatgcaaggcaacttgctttgaagctaatagccaatgtgacctatgggtataca
gctgctggatttagtggacgcatgccctgtgctgagctcgctgacagtattgtccagtgt
gcccgtagaacattggaaagtgcaatttcatttgttaacacaaatgataggtggaatgct
aaagtcatatatggtgatacagacagcatgtttgtactccttgaaggacgttccgttgaa
gaagcttttcgaattggtcatgaaattgcatcagaagtaactgcaatgaatccaaatcca
gtcacgttaaagatggaaaaggtttacgattcgtgcttcctccttactaagaaacgatat
gttggttatagttacgagaaccttggccaaagcaaaccagtgtttgatgctaaaggtatt
gagacagtacgaagagatacatgtggggctgtgtccaagataatggagcgctctataaga
gtcttttttgaatataaggatattgagaaggtgaaacattacttggtgcgtcagtggaaa
aagattatatcaggcagagtatctcttcaggattttgtctttgcaaaagaggtacgctta
ggcacctattccgcacaggcttcttcacttccaccagcagcaattgttgccactaaggca
atgagagtcgaccctagggcagaacctcggtatgcagagcgagtaccttatgttgtggtt
catggtgaacctggtgccaggctggctgatgtcgtggtagatcccttggatcttctttcg
attgattcaccttacaggttaaatgacatatattacatcaagaaacagataatcccagca
ttgcaacgagtatttgggctcgttcgagctgacttgaatcagtggttttcagatatgcct
cgtccagagcgggaggctgctggtaaacgtcacccatttgcagcaaatgcgcacagaact
agaattgattattactatatgtcaaaacattgtatcctatgcggtgagttgatccaggca
tctagttacgtctgtcaaaactgttccagaaacgaagctgtagttgctgctgcattaaca
ggaagaacttcaatattggaaagaaacatccaacaccttgctactatatgtcggcactgt
ggaggaggagattggctagtagaaagtggggtgaaatgcatctctcttgcgtgctctgtt
ttctttgaaaggaggaaaatccagaaagaactgcgatctctttctgctgttactacagat
gcaggtttttatcccagttgtgtcgtggaatggttctaa

DBGET integrated database retrieval system