KEGG   Nicotiana tomentosiformis: 104119381Help
Entry
104119381         CDS       T05025                                 

Definition
(RefSeq) dihydrolipoyllysine-residue acetyltransferase component 4 of pyruvate dehydrogenase complex, chloroplastic-like isoform X1
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
nto  Nicotiana tomentosiformis
Pathway
nto00010  Glycolysis / Gluconeogenesis
nto00020  Citrate cycle (TCA cycle)
nto00620  Pyruvate metabolism
nto01100  Metabolic pathways
nto01110  Biosynthesis of secondary metabolites
nto01200  Carbon metabolism
Module
nto_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:nto00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    104119381
   00020 Citrate cycle (TCA cycle)
    104119381
   00620 Pyruvate metabolism
    104119381
Enzymes [BR:nto01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     104119381
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding
Motif
Other DBs
NCBI-GeneID: 104119381
NCBI-ProteinID: XP_009629164
LinkDB All DBs
Position
Unknown
AA seq 456 aa AA seqDB search
MASLLHSKSPALSFSSTISSPSSLRSSVAAAFPRQYKLPAIQSKIREIFMPALSSTMTEG
KIVSWTKSEGDVLSKGESVVVVESDKADMDVETFYGGILAAIVVNEGDTAPVGAPIGLLA
ETEDEIAEAKIRAKGQSKLETSPANTTTSDAAAAAAPKVAIVATPYAKKLAKQHKVDINK
VTGTGAFGRITPEDVEKAAGITKSIPASTAVAALIPAAAAPAKASPTSFPDIPGSTLVPF
TTMQIAVSKNMMESLSVPTFRVGYPVSTNALDALYEKVKPKGVTMTALLAKAAAMALAQH
PVVNATCKDGKSFTYNSSINIAVAVAINGGLITPVLQDADKLDLYLLSQKWKELVDKARA
KQLQPHEYNSGTFTLSNLGMFGVDRFDAILPPGQGAIMAVGASKPTVVSDSEGFFSVKNK
MLVNITADHRIIYGADLAAFLQTFSKIVENPESLTM
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcgcttctccattccaagtccccagctctctcattctcctccacaatctcttct
ccttcttctctccgatcttccgtggcggcggcattccctcgccaatacaaactccccgct
atccaatcgaaaatccgtgagatcttcatgcctgctctcagctctaccatgaccgaaggc
aaaattgtctcctggactaagtccgagggtgacgtcctctccaaaggagaatctgtggtg
gtcgtcgaatctgataaagctgacatggacgtagagacattctacggtggcattctcgct
gctatcgttgtcaacgagggcgatacggctcctgttggcgctcctattgggctcttggct
gagactgaagatgaaattgccgaagccaagattagagccaaaggccaatccaaactagaa
acctctcccgctaataccactaccagtgatgctgctgctgctgctgcccccaaagttgcg
attgtcgccacgccttatgcgaagaagttagcgaagcagcacaaagttgatatcaacaaa
gtgactgggacgggggcatttggacggattaccccggaggatgtcgagaaggccgcaggg
attactaaaagcatccccgcttccactgcagtagctgctctgatccctgctgcggctgct
cctgcaaaagcgtctccaactagctttcctgacattccagggtcgacccttgttcctttc
accacaatgcaaattgcagtatcaaagaatatgatggagagcctctctgttcccacattc
cgtgttggatatccagttagtacgaacgcccttgatgcgctgtatgaaaaggttaagcca
aaaggcgttacaatgactgcactgttagctaaagctgcagcaatggctctggctcaacat
ccagttgtgaacgccacttgtaaagacggaaagagctttacttataatagcagtataaat
attgctgttgctgtggcaattaatggtggattgatcaccccagtgcttcaggatgctgac
aagttggatctttatctattgtctcaaaagtggaaggaattggtagacaaggctagggct
aagcaacttcagccacacgagtacaattcagggactttcacgttgtccaacttaggcatg
tttggtgtggacagatttgatgctattcttcctcccggccagggggctattatggctgtt
ggagcatcaaaaccaactgttgtctctgactctgaaggtttcttctctgtcaaaaataag
atgctggtgaatatcacagcagatcaccggattatttatggtgctgacttggcagccttc
cttcaaacgttctcaaagattgtcgagaacccagagagcttgacaatgtag

DBGET integrated database retrieval system