KEGG   Nicotiana tomentosiformis: 104121151Help
Entry
104121151         CDS       T05025                                 

Definition
(RefSeq) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
nto  Nicotiana tomentosiformis
Pathway
nto00250  Alanine, aspartate and glutamate metabolism
nto00410  beta-Alanine metabolism
nto00430  Taurine and hypotaurine metabolism
nto00650  Butanoate metabolism
nto01100  Metabolic pathways
nto01110  Biosynthesis of secondary metabolites
Module
nto_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:nto00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    104121151
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    104121151
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    104121151
   00430 Taurine and hypotaurine metabolism
    104121151
Enzymes [BR:nto01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     104121151
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 Peptidase_M11
Motif
Other DBs
NCBI-GeneID: 104121151
NCBI-ProteinID: XP_009631358
LinkDB All DBs
Position
Unknown
AA seq 496 aa AA seqDB search
MVLSKTASESDVSIHSTFASRYVRTSLPRFKMPENSIPKEAAYQIINDELMLDGNPRLNL
ASFVTTWMEPECNKLMMDSINKNYVDMDEYPVTTELQNRCVNMIAHLFNAPLGDGETAVG
VGTVGSSEAIMLAGLAFKRKWQNKMKAQGKPCDKPNIVTGANVQVCWEKFARYFEVELKE
VKLSDGYYVMDPEKAVEMVDENTICVAAILGSTLNGEFEDVKRLNDLLIEKNKETGWDTP
IHVDAASGGFIAPFLYPELEWDFRLPLVKSINVSGHKYGLVYAGIGWAIWRNKEDLPDEL
IFHINYLGADQPTFTLNFSKGSSQVIAQYYQLIRLGFEGYKNVMENCQENARVLREGLEK
SGRFNIISKEIGVPLVAFSLKDNSQHNEFEISETLRRFGWIIPAYTMPPNAQHVTVLRVV
IREDFSRTLAERLVIDIEKVLHELDTLPARVNAKLAVAEANGSGVHKKTDREVQLEITTA
WKKFVADKKKKTNGVC
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atggttctgtccaagacagcgtcggaaagtgacgtctccatccactccactttcgcttcc
cgatatgttcgtacttctcttccgaggtttaagatgccagagaattcgataccaaaggaa
gcagcatatcaaatcataaatgatgagcttatgttagatggaaatccaagactaaattta
gcatcttttgtgacaacatggatggaaccagagtgtaacaaactgatgatggattccatt
aacaagaattacgttgacatggatgaataccctgtaaccactgaacttcagaatcgatgt
gtaaacatgatagctcatttgtttaacgcaccacttggagatggagagactgcagttgga
gttggaactgttggatcctctgaggctattatgcttgctggattagctttcaagagaaaa
tggcaaaataaaatgaaagcccaaggcaagccctgtgacaagcccaatattgtcactggt
gccaatgtccaggtgtgttgggagaaatttgcaaggtattttgaagtggagttgaaagaa
gtaaaattgagtgatggatactatgtgatggaccctgagaaagctgtggaaatggtggat
gagaacacaatttgtgtagctgctatcttgggttccacactcaatggtgaatttgaagat
gttaagcgcttgaatgacctcttgattgagaagaacaaagaaaccgggtgggacactcca
attcatgtggatgcagcaagtggtggatttattgcaccattcctttatccagagcttgaa
tgggactttagattgccattggtgaagagtattaacgtgagtggtcacaaatatggtctt
gtttatgctggtattggttgggccatttggaggaataaggaagacttacctgacgaactt
atcttccacattaattatcttggtgctgatcaacctactttcactctcaacttctctaaa
ggttctagccaagtaattgctcaatattaccaacttattcgcttgggttttgagggttac
aagaatgttatggagaattgtcaagaaaatgcaagggtactaagagaaggacttgaaaaa
agtggaagattcaacataatatccaaagaaattggagttccattagtagctttctctctt
aaagacaacagtcaacacaatgagttcgaaatttctgaaactcttagaagatttggatgg
attattcctgcatatactatgccaccaaatgctcaacatgtcacagttctcagagttgtc
attagagaagatttctcccgtacactcgccgagcgactggtaatagacattgaaaaagtc
ctccacgagctagacacacttccggcgagggtcaacgctaagctagccgtggccgaggcg
aatggcagcggcgtgcataagaaaacagatagagaagtgcagcttgagattactactgca
tggaagaaatttgttgctgataagaagaagaagactaacggagtttgttaa

DBGET integrated database retrieval system