KEGG   Nicotiana tomentosiformis: 3776288Help
Entry
3776288           CDS       T05025                                 

Gene name
rbcL, NitoCp038
Definition
(RefSeq) ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
nto  Nicotiana tomentosiformis
Pathway
nto00630  Glyoxylate and dicarboxylate metabolism
nto00710  Carbon fixation in photosynthetic organisms
nto01100  Metabolic pathways
nto01200  Carbon metabolism
Module
nto_M00165  Reductive pentose phosphate cycle (Calvin cycle)
nto_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
nto_M00532  Photorespiration
nto_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:nto00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    3776288 (rbcL)
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    3776288 (rbcL)
Enzymes [BR:nto01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     3776288 (rbcL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-GeneID: 3776288
NCBI-ProteinID: YP_398871
UniProt: Q33C26
LinkDB All DBs
AA seq 477 aa AA seqDB search
MSPQTETKASVGFKAGVKEYKLTYYTPEYQTKDTDILAAFRVTPQPGVPPEEAGAAVAAE
SSTGTWTTVWTDGLTSLDRYKGRCYRIERVVGEKDQYIAYVAYPLDLFEEGSVTNMFTSI
VGNVFGFKALRALRLEDLRIPPAYVKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGL
SAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWRDRFLFCAEALYKAQAETGEIKGHYL
NATAGTCEEMIKRAVFARELGVPIVMHDYLTGGFTANTSLAHYCRDNGLLLHIHRAMHAV
IDRQKNHGIHFRVLAKALRMSGGDHIHSGTVVGKLEGERDITLGFVDLLRDDFVEQDRSR
GIYFTQDWVSLPGVLPVASGGIHVWHMPALTEIFGDDSVLQFGGGTLGHPWGNAPGAVAN
RVALEACVQARNEGRDLAQEGNEIIREACKWSPELAAACEVWKEIVFNFAAVDVLDK
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgtcaccacaaacagagactaaagcaagtgttggattcaaagctggtgttaaagagtac
aaattgacttattatactcctgagtaccaaaccaaggatactgatatattggcagcattc
cgagtaactcctcaacctggagttccacctgaagaagcaggggccgcggtagctgccgaa
tcttctactggtacatggacaactgtatggaccgatggacttaccagccttgatcgttac
aaagggcgatgctaccgcatcgagcgtgttgttggagaaaaagatcaatatattgcttat
gtagcttaccccttagacctttttgaagaaggttctgttaccaacatgtttacttccatt
gtaggtaacgtatttgggttcaaagccctgcgcgctctacgtctggaagatctgcgaatc
cctcctgcttatgttaaaactttccaaggtccgcctcacgggatccaagttgaaagagat
aaattgaacaagtatggtcgtcccctgttgggatgtactattaaacctaaattggggtta
tccgctaaaaactacggtagagctgtttatgaatgtcttcgcggtggacttgattttacc
aaagatgatgagaacgtgaactcacaaccatttatgcgttggagagatcgtttcttattt
tgtgccgaagcactttataaagcacaggctgaaacaggtgaaatcaaagggcattacttg
aatgctactgcaggtacatgcgaagaaatgatcaaaagagctgtatttgctagagaattg
ggtgttccgatcgtaatgcatgactacttaacggggggattcaccgcaaatactagcttg
gctcattattgccgagataatggtctacttcttcacatccaccgtgcaatgcatgcggtt
attgatagacagaagaatcatggtatccacttccgggtattagcaaaagcgttacgtatg
tctggtggagatcatattcactctggtaccgtagtaggtaaacttgaaggtgaaagagac
ataactttgggctttgttgatttactgcgtgatgattttgttgaacaagatcgaagtcgc
ggtatttatttcactcaagattgggtctctttaccaggtgttctacccgtggcttcagga
ggtattcacgtttggcatatgcctgctctgaccgagatctttggggatgattccgtacta
cagttcggtggaggaactttaggacatccttggggtaatgcgccaggtgccgtagctaat
cgagtagctctagaagcatgtgtacaagctcgtaatgaaggacgtgatcttgctcaggaa
ggtaatgaaattattcgcgaggcttgcaaatggagcccggaactagctgctgcttgtgaa
gtatggaaagagatcgtatttaattttgcagcagtggacgttttggataagtaa

DBGET integrated database retrieval system