KEGG   Nocardia terpenica: CRH09_00200Help
Entry
CRH09_00200       CDS       T05168                                 

Definition
(GenBank) serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
ntp  Nocardia terpenica
Brite
KEGG Orthology (KO) [BR:ntp00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ntp01001]
    CRH09_00200
Enzymes [BR:ntp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     CRH09_00200
Protein kinases [BR:ntp01001]
 Serine/threonine kinases: Other
  Bacterial family
   CRH09_00200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase PASTA Pkinase_Tyr APH Pkinase_fungal Kinase-like Kdo ABC1 Seadorna_VP7 RIO1 Haspin_kinase
Motif
Other DBs
NCBI-ProteinID: ATL64890
UniProt: A0A291RC72
LinkDB All DBs
Position
complement(37255..39156)
Genome map
AA seq 633 aa AA seqDB search
MTTPKNLSSRYELGEIIGFGGMSEVHKARDMRLGRDVAIKVLRADLARDPTFYLRFKREA
QNAAALNHPAIVAVYDTGEAEVDGGPLPYIVMEYVDGDTLRDIVRGKGPLPPRRAMEVIA
DVCAALDFSHKNGIVHRDMKPANIMINRQGAVKVMDFGIARAIADSSNPMTQTAAVIGTA
QYLSPEQARGEQVDARSDVYSVGCVLYEILTGEPPFTGDSPIAVAYQHVREDPNLPSHVH
PGVPRELDSVVLKAMAKNPANRYQTAAEMRADLIRVLGGQKPQAPTVMTEEDRTTFLGAV
DSPHRYRGEEMDDQEPPDSGGSRRGLLIGAGVVGAVALLFALFWVLIGPGSNSDQITIPD
NLANKPVAQVQDQLQKAGFSVAIQQKPDSKVAINNVISTQPMGGSRAPRGSTVTVQVSSG
PQAVPVPDLTKLTQQQADQKLTASDLRLDPNVQRDFSSPDDKDKVIRQSSPPGSKIDAGS
PIAITLGKGPEQVRVPDVVGQQIDVARPNLEDSAGFKVVVQRVNSSSPPGQVLATDPSGG
SMADKGSTITVQVATSDQITAPDLRGLTASQAFDKLRASGWTGGMSQIIQSNRPTLDGSS
VGKVLDQSPAPGSPLSKTGAVTIYVGVLLLGPP
NT seq 1902 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccccgaagaatctgtcctctcggtacgagctgggcgagatcatcgggttcggc
ggaatgtcggaggtgcacaaggcccgcgacatgcgtctcggccgggacgtggcgatcaag
gtgctgcgcgccgatctggcccgcgaccccaccttctatctgcggttcaaacgcgaggcc
cagaacgcggccgcgctgaatcatccggcgatcgtggcggtttacgacaccggtgaggcc
gaggtcgacggcggtccgctgccctacatcgtgatggagtacgtcgacggcgacaccctg
cgcgacatcgtgcgcggcaaaggcccgctgccgccgcggcgcgcgatggaggtcatcgcg
gatgtgtgtgcggcgctggacttcagccacaagaacggcatcgtgcaccgcgatatgaag
ccggccaacatcatgatcaaccggcagggcgcggtgaaggtgatggacttcggcatcgcc
cgcgcgatcgccgacagctccaatccgatgacgcagaccgctgcggtgatcggcaccgcg
cagtatctgtcgcccgagcaggcccgcggcgaacaggtcgacgcgcgctcggacgtctac
tccgtgggctgcgtgctgtacgagatcctcacgggcgagccgcctttcaccggtgactcg
ccgatcgcggtggcctaccagcatgtgcgggaggatccgaatctgccctcgcacgtgcat
ccgggcgtgccgcgcgaactcgactcggtcgtgctcaaggcgatggccaagaatccggcc
aaccgctatcagaccgcggcggagatgcgcgccgacctgatccgggtgctgggcgggcag
aagccgcaggcgcccacggtgatgaccgaggaggaccgcaccaccttcctgggcgcggtc
gattcgccgcatcgctatcgcggcgaggagatggacgatcaggagccgccggattctggt
ggttcgcgccgcgggttgctgatcggcgcgggtgtggtcggtgcggtggcgctgctgttc
gcgctgttctgggtgctgatcggcccgggcagcaattcggaccagatcacgattccggac
aacctggcgaacaagccggtcgcccaggtgcaggatcagttgcagaaggccggtttctcg
gtcgccatccagcagaagcccgacagcaaagtggcgatcaacaatgtgatttccacgcag
ccgatgggcggttcccgggcgccgaggggcagcaccgtcaccgtgcaggtgtccagcggc
ccgcaggcggtcccggtgccggatctgacgaaactcactcagcagcaggcggatcagaag
ctgacggcctcggacctgcggctggatccgaacgtgcagcgcgacttctccagccccgac
gacaaggacaaggtgatccggcagagctccccgccgggctcgaagatcgacgcgggcagc
ccgatcgccatcaccctgggcaagggccccgagcaggtgcgcgtccccgacgtggtgggc
cagcagatcgacgtggcccggccgaacctggaggacagcgcgggcttcaaggtggtcgtc
cagcgcgtgaactcctccagccccccgggccaggtactggccaccgacccctccggcggc
tccatggccgacaagggctccaccatcaccgttcaggtcgccaccagcgaccagatcacc
gcccccgacctgcgcggcctgaccgcctcccaggcattcgacaaactccgcgcgtccggc
tggaccggcggcatgagccaaatcatccagtccaaccgccccaccctcgacggcagcagc
gtaggcaaagtcctagaccaatcccccgcccccggctcccccctctccaaaaccggcgca
gtaacaatctacgtcggcgtcctcctcctcggccccccataa

DBGET integrated database retrieval system