KEGG   Nocardia terpenica: CRH09_05895Help
Entry
CRH09_05895       CDS       T05168                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
ntp  Nocardia terpenica
Pathway
ntp00473  D-Alanine metabolism
ntp01100  Metabolic pathways
ntp01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:ntp00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    CRH09_05895
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    CRH09_05895
Enzymes [BR:ntp01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     CRH09_05895
Peptidoglycan biosynthesis and degradation proteins [BR:ntp01011]
 Precursor biosynthesis
  Racemase
   CRH09_05895
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: ATL65819
UniProt: A0A291RET7
LinkDB All DBs
Position
1292267..1293439
Genome map
AA seq 390 aa AA seqDB search
MAGSVTVSSADPQAEAVVDLDAVAHNVRTLREYAGDAAVMAVVKADGYNHGAVRIGRAAL
AAGAAELGVTTIAEALALRAAGIDAPILSWLNTSDADYPAAVAADIEIGVSSVAQLRAVE
RAARSTGRTATVTLKVDTGLNRNGIPETEYPKVLTLLRELVAEQSVRFRAMFSHLARADE
PQHPAIDVQRDRFMDAIALAKDHGLQPDLVHLANSAAALTRPDLAFDMIRPGIAVYGLSP
VPEISDFGLRPAMTFRARVALVKPVAAGEGVSYGHEWIAPRDTTVALVPVGYADGVPRSL
GGRIGIRLGERDYPAVGRVCMDQLMVDLGDNPAGVREGDPAVLFGGAPGDPHPQRWADLL
ETIHYEIVCFPRGRVVRRYVGDPRRPGGAL
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
gtggcaggatcggtaaccgtgagtagtgctgatccacaggcggaggccgtcgtcgatctg
gatgccgtggcacacaacgtccggacgctgcgcgagtacgcgggcgacgccgcggtcatg
gcggtggtcaaggccgacggatacaaccacggcgcggtgcggatcggccgcgcggcgctg
gcggccggtgcggccgaactcggcgtcaccaccatcgccgaggccctggccctgcgcgcc
gcgggcatcgatgccccgattctgagctggctcaacacctccgacgccgactaccccgcc
gccgtcgccgccgatatcgagatcggcgtgtcctcggtggcgcaactgcgcgcggtcgag
cgggccgcgcgcagcaccggccggaccgccacggtgaccctcaaggtggacaccggcctg
aaccgcaacggcatccccgaaaccgaatacccgaaagtcctgaccctgctgcgagaactg
gtcgccgagcagtcggtccggttccgcgccatgttctcccacctcgcccgcgccgacgag
ccccagcatccggcgatcgacgtgcagcgcgaccgcttcatggacgccatcgccctcgcc
aaggaccacggcctgcaacccgacctggtgcacctggccaactccgccgcggcgctcacc
cgccccgacctcgccttcgacatgatccgccccggcatcgcggtctacggcctgtcaccc
gtccccgagatctccgatttcggcctgcgccccgcgatgaccttccgggcgcgggtggcg
ctggtcaagccggtcgccgcgggggagggcgtctcctacgggcacgaatggatcgccccg
cgcgacaccaccgtcgccctcgtcccggtcgggtacgccgacggtgtgccgcgctcgctg
ggcggccgcatcggaatccgcctcggcgagcgggactaccccgccgtcggccgggtgtgc
atggatcagctgatggtcgacctgggcgacaatcccgccggggtgcgggagggcgacccg
gcggtcctgttcggcggcgcgcccggcgatccgcacccccagcggtgggccgacctgctc
gaaaccatccactacgagatcgtctgtttcccccgcggccgagtcgtgcgacgctatgtg
ggcgatccacgacggccagggggtgcgctatga

DBGET integrated database retrieval system