KEGG   Nocardia terpenica: CRH09_06125Help
Entry
CRH09_06125       CDS       T05168                                 

Definition
(GenBank) isocitrate dehydrogenase (NADP(+))
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
ntp  Nocardia terpenica
Pathway
ntp00020  Citrate cycle (TCA cycle)
ntp00480  Glutathione metabolism
ntp01100  Metabolic pathways
ntp01110  Biosynthesis of secondary metabolites
ntp01120  Microbial metabolism in diverse environments
ntp01130  Biosynthesis of antibiotics
ntp01200  Carbon metabolism
ntp01210  2-Oxocarboxylic acid metabolism
ntp01230  Biosynthesis of amino acids
Module
ntp_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ntp_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:ntp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CRH09_06125
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    CRH09_06125
Enzymes [BR:ntp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     CRH09_06125
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: ATL65853
UniProt: A0A161Z9W0
LinkDB All DBs
Position
1342320..1343537
Genome map
AA seq 405 aa AA seqDB search
MSKIKVEGTVVELDGDEMTRIIWQFIKDKLIHPYLDIDLEYYDLGIEYRDKTDDQVTVDA
ANAIKKHGVGVKCATITPDEARVEEFGLKKMWRSPNGTIRNILGGTIFRAPIIISNVPRL
VPGWTKPIIIGRHAFGDQYRATDFKVHQAGTVTLTFTPEDGSEPIVHEVVKVPEDGGVVM
GMYNFKKSIEDFARASMNYGLQQNYPVYLSTKNTILKAYDGMFKDTFQEIYETEFKDQFD
AAGLTYEHRLIDDMVASALKWEGGYVWACKNYDGDVQSDTVAQGFGSLGLMTSVLLTPDG
RTCEAEAAHGTVTRHFRQHQAGKPTSTNPIASIFAWTRGIAHRGKLDNTPEVIGFAQTLE
DVVIKTVENGQMTKDLALLVGGDQGYLTTEEFLGALDANLARELR
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgtccaagatcaaggttgaagggaccgtcgtcgaactcgacggcgacgagatgactcgg
atcatctggcagttcatcaaggacaagctgatccacccgtacctcgacatcgacctcgag
tactacgacctgggtatcgaataccgggacaagaccgacgaccaggtgaccgtcgacgcc
gccaacgccatcaagaagcacggcgtgggcgtcaaatgcgccaccatcacccccgacgag
gcgcgtgtcgaggagttcggcctcaagaagatgtggcggtcgcccaacggcaccatccgc
aacatcctcggcggcaccatcttccgcgccccgatcatcatctccaacgtgccgcgcctg
gtgccgggctggaccaagccgatcatcatcggccgtcacgccttcggtgaccagtaccgc
gccaccgatttcaaggtgcaccaggcgggcaccgtcaccctcaccttcacccccgaggac
ggcagcgagccgatcgtccacgaggtcgtgaaggttcccgaggacggcggcgtcgtcatg
ggcatgtacaacttcaagaagtccatcgaggacttcgcgcgcgcgtcgatgaactacggc
ctgcagcagaactacccggtctacctctccaccaagaacacgatcctgaaggcctacgac
ggcatgttcaaggacacgttccaggagatctacgagaccgagttcaaggaccagttcgac
gccgcgggcctcacctacgagcaccgcctcatcgacgacatggtcgcctccgccctgaag
tgggagggcggctatgtgtgggcctgtaagaactacgacggcgacgtgcagtccgacacc
gtggcgcagggcttcggctcgctgggcctgatgacctcggtgctgctcaccccggacggc
cggacctgcgaggccgaggccgcgcacggcaccgtgacccgccacttccgccagcaccag
gcgggcaagccgacctccaccaatccgatcgcctcgatcttcgcgtggacccgcggcatc
gctcatcgcggcaagctggacaacacccccgaggtcatcggcttcgcgcagaccctcgag
gacgtcgtcatcaagaccgtcgagaacggccagatgaccaaggacctggcgctgctggtc
ggcggcgatcagggttatctgaccaccgaggaattcctcggtgctctcgacgccaacctg
gcgcgcgagctgcgctag

DBGET integrated database retrieval system