KEGG   Nocardia terpenica: CRH09_06325Help
Entry
CRH09_06325       CDS       T05168                                 

Definition
(GenBank) succinate dehydrogenase iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
ntp  Nocardia terpenica
Pathway
ntp00020  Citrate cycle (TCA cycle)
ntp00190  Oxidative phosphorylation
ntp00650  Butanoate metabolism
ntp01100  Metabolic pathways
ntp01110  Biosynthesis of secondary metabolites
ntp01120  Microbial metabolism in diverse environments
ntp01130  Biosynthesis of antibiotics
ntp01200  Carbon metabolism
Module
ntp_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ntp_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
ntp_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:ntp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CRH09_06325
   00650 Butanoate metabolism
    CRH09_06325
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    CRH09_06325
Enzymes [BR:ntp01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     CRH09_06325
    1.3.5.4  fumarate reductase (quinol)
     CRH09_06325
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_10 Fer4_17 Fer4_9 Fer4_18 Fer4_7 Fer4_4 Fer4_16 Fer4 Fer4_2
Motif
Other DBs
NCBI-ProteinID: ATL65886
UniProt: A0A164PQY9
LinkDB All DBs
Position
complement(1377070..1377843)
Genome map
AA seq 257 aa AA seqDB search
MTAVAEAPAGQKPAPVPAGATMITVKVARFNPEDGKGAHWDSFQVPVLPTDRFLNVLIYI
KSYLDGTLTFRRSCAHGVCGSDAMRINGVNRLACKVLMSDMLPKGGKALTVTVEPIRGLP
VEKDLVVNMEPFFDAFRAVKPYLITHGNEPTRERIQSQADRARFDDTTKCILCACCTTSC
PVYWNDGSYFGPAAIVNAHRFIFDSRDEGARERLDILNDVEGVWRCRTTFNCTDACPRGI
EVTKAIQEVKRALLFAR
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgactgccgtagccgaagctcccgcaggacagaagcccgcccccgttcccgccggggcg
accatgatcaccgtcaaggtggcgcggttcaatcccgaggacggcaaaggcgcgcactgg
gattcgttccaggtgccggtgctgccgaccgaccgcttcctgaacgtgctcatctacatc
aagtcctacctggacggcacgctcaccttccggcgctcgtgcgcgcacggcgtctgcggt
tcggacgccatgcgcatcaacggcgtcaaccggctggcgtgcaaggtgctgatgagcgac
atgctgcccaagggcggcaaggcgctgaccgtcaccgtcgagcccatccgcggcctgccc
gtggagaaggatctcgtggtgaacatggagccgttcttcgacgcgttccgcgcggtcaag
ccgtacctgatcacgcacggcaacgagcccacccgcgagcgcatccagtcgcaggccgac
cgcgcccgcttcgacgacaccaccaagtgcatcctgtgcgcctgctgcaccacctcgtgc
ccggtgtactggaacgacggcagctacttcggcccggccgcgatcgtgaacgcgcaccgc
ttcatcttcgacagccgcgacgagggcgcccgcgagcgcctggacatcctcaacgacgtc
gagggcgtgtggcgctgccgcaccaccttcaactgcaccgacgcgtgcccgcgcggcatc
gaggtcaccaaggccatccaggaagtcaagcgcgccctgctgttcgcccgctga

DBGET integrated database retrieval system